LXL04_025947 | RubberDandelionOmics

Gene overview

LXL04_025947

Reference: OH-1004 Chr: Chr05 Coordinates: 118881201-118881686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_025947|LXL04_025947|OH1004|cDNA

ATGCTTTGTTCATATCATCATCGAAGTCATGTCAAACCATCTTCCGTCAAACAAGGCGGTAGATTCAGAAACACATGTTGGTTGTTGATCTTCTTTCTCTTATTAACCACCATCCAGTCGATATCTGGTTCTGATTTTGGATCTGGTTCTGGTTCTGGTTCTAATATTCCTACACACTCGAATTTCTTTCGAGCTGTGTCTAGGGGAAGACAACGGGTTTTAGGGTGTCAAAACGACCCAAACTTTTGTTCTGATCGTAA...

CDS

Download CDS FASTA

486 bp · LXL04_025947|LXL04_025947|OH1004|CDS

ATGCTTTGTTCATATCATCATCGAAGTCATGTCAAACCATCTTCCGTCAAACAAGGCGGTAGATTCAGAAACACATGTTGGTTGTTGATCTTCTTTCTCTTATTAACCACCATCCAGTCGATATCTGGTTCTGATTTTGGATCTGGTTCTGGTTCTGGTTCTAATATTCCTACACACTCGAATTTCTTTCGAGCTGTGTCTAGGGGAAGACAACGGGTTTTAGGGTGTCAAAACGACCCAAACTTTTGTTCTGATCGTAA...

Protein

Download Protein FASTA

161 aa · LXL04_025947|LXL04_025947|OH1004|PROTEIN

MLCSYHHRSHVKPSSVKQGGRFRNTCWLLIFFLLLTTIQSISGSDFGSGSGSGSNIPTHSNFFRAVSRGRQRVLGCQNDPNFCSDRKKNPWGGSVCCFGKFCKDVMSDRNHCGGCGHVCGYEVVCCGGECVDVRNDGRHCGGCFEECGGQGRCSYGMCDYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025947`
TK1151 ID	TkA06G037370
OH-1004 ID	LXL04_025947
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025947

Location Chr05:118881201-118881686 (-)

Description Similar to KRS: Stigma-specific STIG1-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50650`	Endosperm-specific cysteine-rich protein that acts downstream of BHLH95/ZOU to modify the interface between embryo and endosperm and mediate the separation of these two tissues during seed development.	No verified direct reference in this release
`At1g53130`	Involved in the regulation of cell death induced by extracellular reactive oxygen species.	No verified direct reference in this release
`At1g50720`	Stigma-specific STIG1-like protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025947 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010193 response to ozone Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0048316 seed development Biological Process

GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

KEGG gene cross-reference

ath:AT1G50650

ath:AT1G50720

ath:AT1G53130

sly:543904

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.410

Rank 1 · LXL04_025947 · OH-1004

Cell membrane0.181

Rank 2 · LXL04_025947 · OH-1004

Endoplasmic reticulum0.149

Rank 3 · LXL04_025947 · OH-1004

Lysosome / Vacuole0.107

Rank 4 · LXL04_025947 · OH-1004

Cytoplasm0.093

Rank 5 · LXL04_025947 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04885.20Stig175-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025947	`PF04885.20`	Stig1	75	160	2.2e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6P6`	Arabidopsis thaliana	Stigma-specific STIG1-like protein 4	33.083%	Swiss-Prot	moderate database homology
`Q9LNN7`	Arabidopsis thaliana	Protein GRIM REAPER	29.139%	Swiss-Prot	weak database homology
`Q9C6T5`	Arabidopsis thaliana	Stigma-specific STIG1-like protein 3	27.632%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card