LXL04_025927 | RubberDandelionOmics

Gene overview

LXL04_025927

Reference: OH-1004 Chr: Chr05 Coordinates: 118642716-118645363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1896 bp · LXL04_025927|LXL04_025927|OH1004|cDNA

atgTATGCAGCAAATCACTGGGGAGGATCACTGGAAATAGCAAATGAAAATGAACATGATCAAGATCGAAACGGAAGAAACAAGAACATGGAGGACTTGGACAAATCATCGTTATATAACATGCAAAGTCAATATAGCGGAACCCTAGACCAGACTCAACAGAGTTGGCTTCTGGATCCAAATGAAGCTTCCAGGAAGAAGAACAAGACCAGGTATGTGGATCTCGGGTGCATCGTCGTGAAGCGGAAAGTGTTGAAATG...

CDS

Download CDS FASTA

1896 bp · LXL04_025927|LXL04_025927|OH1004|CDS

ATGTATGCAGCAAATCACTGGGGAGGATCACTGGAAATAGCAAATGAAAATGAACATGATCAAGATCGAAACGGAAGAAACAAGAACATGGAGGACTTGGACAAATCATCGTTATATAACATGCAAAGTCAATATAGCGGAACCCTAGACCAGACTCAACAGAGTTGGCTTCTGGATCCAAATGAAGCTTCCAGGAAGAAGAACAAGACCAGGTATGTGGATCTCGGGTGCATCGTCGTGAAGCGGAAAGTGTTGAAATG...

Protein

Download Protein FASTA

631 aa · LXL04_025927|LXL04_025927|OH1004|PROTEIN

MYAANHWGGSLEIANENEHDQDRNGRNKNMEDLDKSSLYNMQSQYSGTLDQTQQSWLLDPNEASRKKNKTRYVDLGCIVVKRKVLKWSVIAVLVAFLVIGLPVIIAKSIPKHKSRPPPPDQYTEALHKALLFFNAQKSGRLPKNNGIKWRGNSGLQDGSDITDVKGGLVGGYYDAGDNTKFNFPMSFAMTMLSWSVIEYEHKYKYVKEYDHARELIKWGTDYLLRTFNSSASKIDHIYGQVGGSQNGSSTPDDHTCWERP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025927`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025927

Location Chr05:118642716-118645363 (+)

Description Similar to GLU3: Endoglucanase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65610`	Endoglucanase 7.	No verified direct reference in this release
`At5g49720`	Required for cellulose microfibril formation.	KORRIGAN, an Arabidopsis endo-1,4-beta-glucanase, localizes to the cell plate by polarized targeting and is essential for cytokinesis.2000 · DOI: 10.1105/tpc.12.7.1137 Temperature-sensitive alleles of RSW2 link the KORRIGAN endo-1,4-beta-glucanase to cellulose synthesis and cytokinesis in Arabidopsis.2001 · DOI: 10.1104/pp.126.1.278 An Arabidopsis endo-1,4-beta-D-glucanase involved in cellulose synthesis undergoes regulated intracellular cycling.2005 · DOI: 10.1105/tpc.105.036228

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0497200`	Endoglucanase 12.	No verified direct reference in this release
`Os03g0736300`	Endoglucanase 10.	No verified direct reference in this release
`Os03g0329500`	Involved in cell wall assembly during cell elongation.	OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation.2006 · DOI: 10.1007/s11103-005-2972-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025927 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009735 response to cytokinin Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048367 shoot system development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G65610

ath:AT5G49720

dosa:Os03g0329500

dosa:Os03g0736300

dosa:Os04g0497200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.797

Rank 1 · LXL04_025927 · OH-1004

Cytoplasm0.148

Rank 2 · LXL04_025927 · OH-1004

Extracellular0.072

Rank 3 · LXL04_025927 · OH-1004

Golgi apparatus0.058

Rank 4 · LXL04_025927 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_025927 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_9122-594 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025927	`PF00759.26`	Glyco_hydro_9	122	594	1.1e-137	460.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04478`	Arabidopsis thaliana	Endoglucanase 7	56.418%	Swiss-Prot	strong database homology
`Q38890`	Arabidopsis thaliana	Endoglucanase 25	58.871%	Swiss-Prot	strong database homology
`Q7XUK4`	Oryza sativa subsp. japonica	Endoglucanase 12	63.407%	Swiss-Prot	strong database homology
`Q84R49`	Oryza sativa subsp. japonica	Endoglucanase 10	56.625%	Swiss-Prot	strong database homology
`P0C1U4`	Oryza sativa subsp. japonica	Endoglucanase 9	57.443%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card