LXL04_025911 | RubberDandelionOmics

Gene overview

LXL04_025911

Reference: OH-1004 Chr: Chr05 Coordinates: 118473642-118475661 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · LXL04_025911|LXL04_025911|OH1004|cDNA

ATGAGTAGTAGGTATAGAAAGTCAATTCGTCAGTGCCGCCGGGATGGCGGCGTTGAGGTAGGTGGTAGTGCCGCCTCCGATGAGGGTTTGCCGGAAATTGCAGTAGCCACGAAGCTTAGGTCAAAGCCCCATCAGTTCTATAGCCGAATATTGCCTGGAAAGTCAGAAGGAATGCCGATTTCCCCGGTCAAAATGTTGGCAGGTCGCGAAGGTAATTACTCCGGGAGAGGTAGATTCACATCTGCAGATCGTTGTCACCT...

CDS

Download CDS FASTA

1368 bp · LXL04_025911|LXL04_025911|OH1004|CDS

ATGAGTAGTAGGTATAGAAAGTCAATTCGTCAGTGCCGCCGGGATGGCGGCGTTGAGGTAGGTGGTAGTGCCGCCTCCGATGAGGGTTTGCCGGAAATTGCAGTAGCCACGAAGCTTAGGTCAAAGCCCCATCAGTTCTATAGCCGAATATTGCCTGGAAAGTCAGAAGGAATGCCGATTTCCCCGGTCAAAATGTTGGCAGGTCGCGAAGGTAATTACTCCGGGAGAGGTAGATTCACATCTGCAGATCGTTGTCACCT...

Protein

Download Protein FASTA

455 aa · LXL04_025911|LXL04_025911|OH1004|PROTEIN

MSSRYRKSIRQCRRDGGVEVGGSAASDEGLPEIAVATKLRSKPHQFYSRILPGKSEGMPISPVKMLAGREGNYSGRGRFTSADRCHLSSRYLPVNGPSVIDQMSSCAYVSQFSADGTLFVAGFQDSDIKIYSVDNDWKVKKNIRARSLRWTITDTSLSPDQRFLVYSSMSPVVHIVNIGSSMTESVANVTEIHEGLDFSGHDGEEEDDYSFGIFSVKFSTDGRELVAATSDDSIYVYDLVANKLNVRIPAHKSDVNAVCF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025911`
TK1151 ID	TkA06G035770
OH-1004 ID	LXL04_025911
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_025911`
Location	Chr05:118473642-118475661 (-)
Description	Similar to LEC14B homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025911` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0003016 respiratory system process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0007005 mitochondrion organization Biological Process GO:0010467 gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0050821 protein stabilization Biological Process GO:0005654 nucleoplasm Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	bta:539433 mmu:28199 rno:305895 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.587

Rank 1 · LXL04_025911 · OH-1004

Cytoplasm0.401

Rank 2 · LXL04_025911 · OH-1004

Lysosome / Vacuole0.052

Rank 3 · LXL04_025911 · OH-1004

Cell membrane0.048

Rank 4 · LXL04_025911 · OH-1004

Mitochondrion0.034

Rank 5 · LXL04_025911 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25174.2Beta-prop_THOC3107-182 aa

PF23414.2Beta-prop_EML_2108-181 aa

PF24814.2WD40_Prp19111-283 aa

PF25171.2Beta-prop_WDR36-Utp21_1st166-277 aa

PF24782.3WD40_MABP1-WDR62_2nd199-332 aa

PF25391.2WD40_Gbeta207-283 aa

PF25175.2Beta-prop_WDR5212-334 aa

PF23414.2Beta-prop_EML_2212-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025911	`PF25174.2`	Beta-prop_THOC3	107	182	3.4e-30	105.7
LXL04_025911	`PF23414.2`	Beta-prop_EML_2	108	181	1.3e-23	84.4
LXL04_025911	`PF24814.2`	WD40_Prp19	111	283	5.5e-29	101.8
LXL04_025911	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	166	277	1.6e-11	44.8
LXL04_025911	`PF24782.3`	WD40_MABP1-WDR62_2nd	199	332	1.8e-13	50.9
LXL04_025911	`PF25391.2`	WD40_Gbeta	207	283	2e-13	50.8
LXL04_025911	`PF25175.2`	Beta-prop_WDR5	212	334	2.1e-35	123.1
LXL04_025911	`PF23414.2`	Beta-prop_EML_2	212	347	1.3e-23	84.4
LXL04_025911	`PF25172.2`	Beta-prop_WDR3_2nd	212	326	1.3e-17	64.6
LXL04_025911	`PF25173.2`	Beta-prop_WDR3_1st	213	281	1.8e-39	136.1
LXL04_025911	`PF25174.2`	Beta-prop_THOC3	213	452	3.4e-30	105.7
LXL04_025911	`PF23381.2`	Beta-prop_IFT122_1st	213	283	1.2e-27	97.7
LXL04_025911	`PF24807.2`	WD40_CDC20-Fz	213	337	6.5e-24	85.5
LXL04_025911	`PF24817.2`	WD40_WDHD1_1st	213	281	3.2e-23	83.1
LXL04_025911	`PF23409.2`	Beta-prop_EML	213	283	1.1e-09	39.0
LXL04_025911	`PF25173.2`	Beta-prop_WDR3_1st	215	332	1.8e-39	136.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card