LXL04_025905 | RubberDandelionOmics

Gene overview

LXL04_025905

Reference: OH-1004 Chr: Chr05 Coordinates: 118369736-118372485 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1431 bp · LXL04_025905|LXL04_025905|OH1004|cDNA

ATGAACAGTCGTGTGGACGATGACGAAGGCTACGATGAATTATCGCCGGTGTCTTCAATGTTGTGGGTTCGTAACCTTCGCCGGTATATCAAATCAGATACGGGTCTTGAATCTGAAGCCATGCTGGAGCTTAAAACAAGAAGAAACTTGGTTAATATTTTCAAAGAGAAGCAGCGAAAGAGCGCAAAATCTGGCATAATTCCAAGTTTCTACAAAAAGAAACCAGAGGATGGTTCCATTAGCCATACGGTTCAGAGGTT...

CDS

Download CDS FASTA

1431 bp · LXL04_025905|LXL04_025905|OH1004|CDS

ATGAACAGTCGTGTGGACGATGACGAAGGCTACGATGAATTATCGCCGGTGTCTTCAATGTTGTGGGTTCGTAACCTTCGCCGGTATATCAAATCAGATACGGGTCTTGAATCTGAAGCCATGCTGGAGCTTAAAACAAGAAGAAACTTGGTTAATATTTTCAAAGAGAAGCAGCGAAAGAGCGCAAAATCTGGCATAATTCCAAGTTTCTACAAAAAGAAACCAGAGGATGGTTCCATTAGCCATACGGTTCAGAGGTT...

Protein

Download Protein FASTA

476 aa · LXL04_025905|LXL04_025905|OH1004|PROTEIN

MNSRVDDDEGYDELSPVSSMLWVRNLRRYIKSDTGLESEAMLELKTRRNLVNIFKEKQRKSAKSGIIPSFYKKKPEDGSISHTVQRLAKYRFLKKQTDILLNSDDLDAMWLILRENSVIDEATGCEKVNYEDFCQIASLCTEQIGSKCYRFFSPSNFMKFGKDESGRILILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQSYEMEAYIRGLIPNLAQLCDMPTEFVQMYCHIAAHKFFFFCDPSRRGKACITKILLSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025905`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025905

Location Chr05:118369736-118372485 (-)

Description Similar to TON2: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18580`	Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton.	The Arabidopsis TONNEAU2 gene encodes a putative novel protein phosphatase 2A regulatory subunit essential for the control of the cortical cytoskeleton.2002 · DOI: 10.1105/tpc.010402 TONNEAU2/FASS regulates the geometry of microtubule nucleation and cortical array organization in interphase Arabidopsis cells.2012 · DOI: 10.1105/tpc.111.094367

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000913 preprophase band assembly Biological Process

GO:0002759 regulation of antimicrobial humoral response Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0032147 activation of protein kinase activity Biological Process

GO:0035303 regulation of dephosphorylation Biological Process

GO:0051900 regulation of mitochondrial depolarization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT5G18580

bta:533147

hsa:55012

mmu:59032

rno:362739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_025905 · OH-1004

Nucleus0.260

Rank 2 · LXL04_025905 · OH-1004

Cell membrane0.198

Rank 3 · LXL04_025905 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_025905 · OH-1004

Golgi apparatus0.076

Rank 5 · LXL04_025905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30347.1RSA-1_C301-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025905	`PF30347.1`	RSA-1_C	301	459	4.7e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FEE2`	Arabidopsis thaliana	Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2	76.546%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card