LXL04_025881 | RubberDandelionOmics

Gene overview

LXL04_025881

Reference: OH-1004 Chr: Chr05 Coordinates: 118074322-118076485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_025881|LXL04_025881|OH1004|cDNA

ATGGCTTCATCAACAGATCCATGGGTGAGGGAATATAATGAAGCTTCTAAACTTGCTGATGACATCACCAACATGATATCCGCAAGAAGTTCAGTAGGCCCAGGGCCAGAAGCACAACGTCATTCATCTGCTACAAGGAGGAAAATTACAATATTAGGAACCAGACTTGATAGCTTACAGTCTCTTCTAACAAAACTTCCTGCAAACCAACCATTAACAGAAAAGGAGATGAACAAACGTAGAGACATGCTAACAAATTT...

CDS

Download CDS FASTA

651 bp · LXL04_025881|LXL04_025881|OH1004|CDS

ATGGCTTCATCAACAGATCCATGGGTGAGGGAATATAATGAAGCTTCTAAACTTGCTGATGACATCACCAACATGATATCCGCAAGAAGTTCAGTAGGCCCAGGGCCAGAAGCACAACGTCATTCATCTGCTACAAGGAGGAAAATTACAATATTAGGAACCAGACTTGATAGCTTACAGTCTCTTCTAACAAAACTTCCTGCAAACCAACCATTAACAGAAAAGGAGATGAACAAACGTAGAGACATGCTAACAAATTT...

Protein

Download Protein FASTA

216 aa · LXL04_025881|LXL04_025881|OH1004|PROTEIN

MASSTDPWVREYNEASKLADDITNMISARSSVGPGPEAQRHSSATRRKITILGTRLDSLQSLLTKLPANQPLTEKEMNKRRDMLTNLRTKVAQMASSLNMSNFGNRDSLLGPDIKSPDAMSRAIEQDEGLGKLEETVISTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLKRVQRHLAVMNKRMNGGCSCLGILLSVIMIVVLLVSIWMIIKYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025881`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025881

Location Chr05:118074322-118076485 (+)

Description Similar to SYP52: Syntaxin-52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79590`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At1g16240`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At1g28490`	Vesicle trafficking protein that functions in the secretory pathway.	OSM1/SYP61: a syntaxin protein in Arabidopsis controls abscisic acid-mediated and non-abscisic acid-mediated responses to abiotic stress.2002 · DOI: 10.1105/tpc.006981 YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.2005 · DOI: 10.1016/j.jmb.2005.04.061 Isolation and proteomic analysis of the SYP61 compartment reveal its role in exocytic trafficking in Arabidopsis.2012 · DOI: 10.1038/cr.2011.129 Arabidopsis SNAREs SYP61 and SYP121 coordinate the trafficking of plasma membrane aquaporin PIP2;7 to modulate the cell membrane water permeability.2014 · DOI: 10.1105/tpc.114.127159 CESA TRAFFICKING INHIBITOR inhibits cellulose deposition and interferes with the trafficking of cellulose synthase complexes and their associated proteins KORRIGAN1 and POM2/CELLULOSE SYNTHASE INTERACTIVE PROTEIN1.2015 · DOI: 10.1104/pp.114.249003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025881 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0048278 vesicle docking Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G16240

ath:AT1G28490

ath:AT1G79590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.408

Rank 1 · LXL04_025881 · OH-1004

Golgi apparatus0.232

Rank 2 · LXL04_025881 · OH-1004

Cytoplasm0.218

Rank 3 · LXL04_025881 · OH-1004

Cell membrane0.195

Rank 4 · LXL04_025881 · OH-1004

Endoplasmic reticulum0.116

Rank 5 · LXL04_025881 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05739.27SNARE124-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025881	`PF05739.27`	SNARE	124	197	8.2e-11	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KK7`	Arabidopsis thaliana	Syntaxin-52	63.519%	Swiss-Prot	strong database homology
`Q9SA23`	Arabidopsis thaliana	Syntaxin-51	62.661%	Swiss-Prot	strong database homology
`Q946Y7`	Arabidopsis thaliana	Syntaxin-61	22.764%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card