LXL04_025851 | RubberDandelionOmics

Gene overview

LXL04_025851

Reference: OH-1004 Chr: Chr05 Coordinates: 117632013-117634321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2229 bp · LXL04_025851|LXL04_025851|OH1004|cDNA

ATGCTAAAACAATTTACAAGCGACGACTTGGAAGCTCAAGCTAGTAGCACAATCCAAAGTGGGAAACCAATCCAAACCCAGATCAAGAAATCTCCATCTCTCACATGGGGTTTTTCGTCTATACAATCTGAGATGGTTGTTGTATTTGAGACATGGGCACTTATCATTGTTCTTGTGGTTTCTCTTCAAAGTCAAATTCTTGTGATTTCACAAAACTTGTCGTGCAATTCTGATGACCTAAGAGGATTACGAGGTTTCGT...

CDS

Download CDS FASTA

2229 bp · LXL04_025851|LXL04_025851|OH1004|CDS

ATGCTAAAACAATTTACAAGCGACGACTTGGAAGCTCAAGCTAGTAGCACAATCCAAAGTGGGAAACCAATCCAAACCCAGATCAAGAAATCTCCATCTCTCACATGGGGTTTTTCGTCTATACAATCTGAGATGGTTGTTGTATTTGAGACATGGGCACTTATCATTGTTCTTGTGGTTTCTCTTCAAAGTCAAATTCTTGTGATTTCACAAAACTTGTCGTGCAATTCTGATGACCTAAGAGGATTACGAGGTTTCGT...

Protein

Download Protein FASTA

742 aa · LXL04_025851|LXL04_025851|OH1004|PROTEIN

MLKQFTSDDLEAQASSTIQSGKPIQTQIKKSPSLTWGFSSIQSEMVVVFETWALIIVLVVSLQSQILVISQNLSCNSDDLRGLRGFVNVLESPIVGWWPTDSSSSSDCCNWIGITCNSTSGRIVRLELPKKRLIGNFSDSISKLNQLRTLNLSQNFLRGPLPISLFHLPHLEELDLSSNKFNGVLPVNINLPALQLLDISYNAFRSSLPSALCVNSNEIRVLKFALNYFNGTIPPQFGKCSFLERLDLASNFLSGIVRDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025851`
TK1151 ID	TkA06G039920
OH-1004 ID	LXL04_025851
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025851

Location Chr05:117632013-117634321 (-)

Description Similar to PSKR: Phytosulfokine receptor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02220`	Phytosulfokine receptor with both a serine/threonine-protein kinase activity and a guanylate cyclase activity.	Disruption and overexpression of Arabidopsis phytosulfokine receptor gene affects cellular longevity and potential for growth.2006 · DOI: 10.1104/pp.106.081109 The phytosulfokine (PSK) receptor is capable of guanylate cyclase activity and enabling cyclic GMP-dependent signaling in plants.2011 · DOI: 10.1074/jbc.m110.168823 The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050
`At5g53890`	Phytosulfokine receptor with a serine/threonine-protein kinase activity.	No verified direct reference in this release
`At1g17240`	Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.	Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
`At1g72300`	Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity.	Tyrosine-sulfated glycopeptide involved in cellular proliferation and expansion in Arabidopsis.2007 · DOI: 10.1073/pnas.0706403104 The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050 Receptor kinase-mediated control of primary active proton pumping at the plasma membrane.2014 · DOI: 10.1111/tpj.12680

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025851 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045087 innate immune response Biological Process

GO:0045851 pH reduction Biological Process

GO:0051707 response to other organism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G17240

ath:AT1G72300

ath:AT2G02220

ath:AT5G53890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · LXL04_025851 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_025851 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_025851 · OH-1004

Nucleus0.042

Rank 4 · LXL04_025851 · OH-1004

Lysosome / Vacuole0.027

Rank 5 · LXL04_025851 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8126-181 aa

PF12799.14LRR_4146-180 aa

PF13855.13LRR_8234-277 aa

PF12799.14LRR_4265-307 aa

PF13855.13LRR_8288-348 aa

PF13855.13LRR_8361-421 aa

PF12799.14LRR_4361-398 aa

PF23598.2LRR_14458-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025851	`PF13855.13`	LRR_8	126	181	3.5e-42	142.7
LXL04_025851	`PF12799.14`	LRR_4	146	180	6.3e-34	115.9
LXL04_025851	`PF13855.13`	LRR_8	234	277	3.5e-42	142.7
LXL04_025851	`PF12799.14`	LRR_4	265	307	6.3e-34	115.9
LXL04_025851	`PF13855.13`	LRR_8	288	348	3.5e-42	142.7
LXL04_025851	`PF13855.13`	LRR_8	361	421	3.5e-42	142.7
LXL04_025851	`PF12799.14`	LRR_4	361	398	6.3e-34	115.9
LXL04_025851	`PF23598.2`	LRR_14	458	535	3.7e-15	56.3
LXL04_025851	`PF13855.13`	LRR_8	461	520	3.5e-42	142.7
LXL04_025851	`PF13855.13`	LRR_8	575	631	3.5e-42	142.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVR7`	Arabidopsis thaliana	Phytosulfokine receptor 1	54.531%	Swiss-Prot	strong database homology
`Q9FN37`	Arabidopsis thaliana	Phytosulfokine receptor 2	40.086%	Swiss-Prot	moderate database homology
`Q9SHI3`	Arabidopsis thaliana	Receptor-like protein 2	36.326%	Swiss-Prot	moderate database homology
`Q9C7S5`	Arabidopsis thaliana	Tyrosine-sulfated glycopeptide receptor 1	38.279%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card