LXL04_025846 | RubberDandelionOmics

Gene overview

LXL04_025846

Reference: OH-1004 Chr: Chr05 Coordinates: 117592034-117593947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · LXL04_025846|LXL04_025846|OH1004|cDNA

ATGGTGGCATTAGAGTGGCTAAGACCTGTTGTAGATACAATGGGATGGGACTACTGCATTGTTTGGCTATTTGGTGATGATCCTTCAAGGTACATTGAGTGGAGTTGGTGTTGTTGCAATGGTAGTCGAGGTGTTTGTAGAAATGTCAAAGAGGAAATCGATGCAACGAAACAACATTTTCCTCAATTATGCAGAGATACTTATGTTAATCACTCTTTGAGGACAAAAGCTTGCGAGAAACTAGCTACGATTCCTTTTCA...

CDS

Download CDS FASTA

1170 bp · LXL04_025846|LXL04_025846|OH1004|CDS

ATGGTGGCATTAGAGTGGCTAAGACCTGTTGTAGATACAATGGGATGGGACTACTGCATTGTTTGGCTATTTGGTGATGATCCTTCAAGGTACATTGAGTGGAGTTGGTGTTGTTGCAATGGTAGTCGAGGTGTTTGTAGAAATGTCAAAGAGGAAATCGATGCAACGAAACAACATTTTCCTCAATTATGCAGAGATACTTATGTTAATCACTCTTTGAGGACAAAAGCTTGCGAGAAACTAGCTACGATTCCTTTTCA...

Protein

Download Protein FASTA

389 aa · LXL04_025846|LXL04_025846|OH1004|PROTEIN

MVALEWLRPVVDTMGWDYCIVWLFGDDPSRYIEWSWCCCNGSRGVCRNVKEEIDATKQHFPQLCRDTYVNHSLRTKACEKLATIPFHLPLYSGIHGEVAMSSQPAWIHDTIGTQVLMPVNGGLIELYRSKLVQRDPDMIETLTTQFNIFSAKYIMSPKTEASPNGSNSSFISVDSTQFSPINFLGHDVSSKKKQYMKIKQKNGKELYQSKNLVTERNRRNRIKDGLFALRALVPKISKMDRASIVGDAVEYIKELQLNVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025846`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025846

Location Chr05:117592034-117593947 (+)

Description Similar to BHLH90: Transcription factor bHLH90

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10610`	Transcription factor bHLH90.	No verified direct reference in this release
`At2g16910`	Transcription factor.	No verified direct reference in this release
`At1g12860`	Mediates stomatal differentiation in the epidermis probably by controlling successive roles of SPCH, MUTE, and FAMA.	SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848
`At3g26744`	Transcriptional activator that regulates the cold-induced transcription of CBF/DREB1 genes.	SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048397 SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0120500`	Transcription factor involved in the regulation of tapetum programmed cell death (PCD) and degradation during male reproductive development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025846 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0048653 anther development Biological Process

GO:0048654 anther morphogenesis Biological Process

GO:0048657 anther wall tapetum cell differentiation Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0050826 response to freezing Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G10610

ath:AT1G12860

ath:AT2G16910

dosa:Os02g0120500

osa:4328113

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.883

Rank 1 · LXL04_025846 · OH-1004

Cytoplasm0.174

Rank 2 · LXL04_025846 · OH-1004

Cell membrane0.049

Rank 3 · LXL04_025846 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_025846 · OH-1004

Plastid0.014

Rank 5 · LXL04_025846 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215.13bHLH-MYC_N7-146 aa

PF00010.32HLH213-256 aa

PF23177.2bHLH_IRO3213-275 aa

PF22754.5bHLH-TF_ACT-like_plant312-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025846	`PF14215.13`	bHLH-MYC_N	7	146	1.6e-14	55.3
LXL04_025846	`PF00010.32`	HLH	213	256	3.8e-11	43.3
LXL04_025846	`PF23177.2`	bHLH_IRO3	213	275	7.8e-06	26.9
LXL04_025846	`PF22754.5`	bHLH-TF_ACT-like_plant	312	381	1.3e-08	35.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WNR2`	Arabidopsis thaliana	Transcription factor bHLH90	33.641%	Swiss-Prot	moderate database homology
`Q9ZVX2`	Arabidopsis thaliana	Transcription factor ABORTED MICROSPORES	40.884%	Swiss-Prot	weak database homology
`Q9LPW3`	Arabidopsis thaliana	Transcription factor SCREAM2	37.423%	Swiss-Prot	weak database homology
`Q9LSE2`	Arabidopsis thaliana	Transcription factor ICE1	36.316%	Swiss-Prot	weak database homology
`Q6YUS3`	Oryza sativa subsp. japonica	Transcription factor TDR	32.243%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card