LXL04_025798 | RubberDandelionOmics

Gene overview

LXL04_025798

Reference: OH-1004 Chr: Chr05 Coordinates: 117008032-117012787 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2589 bp · LXL04_025798|LXL04_025798|OH1004|cDNA

atggagTACAACATGATCAAGAGCCTCATATTTTCTTCACCAAGATGGTTGTATTCCCATTTATGGTTCTCAGACGTAGCCATAGTATTCCTTatcgtcttcatcttcaactCCATAGTTCAAAGACTCACCACAAAGGGTCCTATGACATGGCCAGTTTTCGGTATACTTCCAACGGTACTCTTACACGTGACCCACATTTATGAATGGGGTGGTGAAGCTTTAGTCAAATCCGGTGGAAGCTTTTACTATAGAGGTAT...

CDS

Download CDS FASTA

2589 bp · LXL04_025798|LXL04_025798|OH1004|CDS

ATGGAGTACAACATGATCAAGAGCCTCATATTTTCTTCACCAAGATGGTTGTATTCCCATTTATGGTTCTCAGACGTAGCCATAGTATTCCTTATCGTCTTCATCTTCAACTCCATAGTTCAAAGACTCACCACAAAGGGTCCTATGACATGGCCAGTTTTCGGTATACTTCCAACGGTACTCTTACACGTGACCCACATTTATGAATGGGGTGGTGAAGCTTTAGTCAAATCCGGTGGAAGCTTTTACTATAGAGGTAT...

Protein

Download Protein FASTA

862 aa · LXL04_025798|LXL04_025798|OH1004|PROTEIN

MEYNMIKSLIFSSPRWLYSHLWFSDVAIVFLIVFIFNSIVQRLTTKGPMTWPVFGILPTVLLHVTHIYEWGGEALVKSGGSFYYRGMWMGGTYGIATCDPEKIEYILKTNFKNYPKGKAYRERFYDFLGDGIFNADDELWRHQRRVANSEMHSARFTQFSMNAIKTLVHEKLLKLLEAKRGCVIDLQDVLLRFTFDNTCAVAFGVNSGCLDVDLPEIPFAKAFEQVTYASLLRFLMPPYVWKPLKFFRLGFEKTLHESVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025798`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025798

Location Chr05:117008032-117012787 (+)

Description Similar to PBB2: Proteasome subunit beta type-7-B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23190`	Involved in very long chain fatty acids (VLCFA) omega- hydroxylation.	CYP86B1 is required for very long chain omega-hydroxyacid and alpha, omega -dicarboxylic acid synthesis in root and seed suberin polyester.2009 · DOI: 10.1104/pp.109.141408 Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907
`At5g40580`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`At3g27430`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`At1g63710`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At1g01600`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335 Nanoridges that characterize the surface morphology of flowers require the synthesis of cutin polyester.2009 · DOI: 10.1073/pnas.0909090106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025798 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01600

ath:AT1G63710

ath:AT3G27430

ath:AT5G23190

ath:AT5G40580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.665

Rank 1 · LXL04_025798 · OH-1004

Cytoplasm0.099

Rank 2 · LXL04_025798 · OH-1004

Mitochondrion0.079

Rank 3 · LXL04_025798 · OH-1004

Nucleus0.066

Rank 4 · LXL04_025798 · OH-1004

Cell membrane0.054

Rank 5 · LXL04_025798 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45048-492 aa

PF00227.32Proteasome625-805 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025798	`PF00067.28`	p450	48	492	1.7e-69	235.5
LXL04_025798	`PF00227.32`	Proteasome	625	805	3.8e-48	164.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY1`	Arabidopsis thaliana	Cytochrome P450 86B1	48.000%	Swiss-Prot	moderate database homology
`Q7DLS1`	Arabidopsis thaliana	Proteasome subunit beta type-7-B	81.752%	Swiss-Prot	weak database homology
`O23710`	Arabidopsis thaliana	Proteasome subunit beta type-7-A	81.387%	Swiss-Prot	weak database homology
`Q9CAD6`	Arabidopsis thaliana	Cytochrome P450 86A7	38.540%	Swiss-Prot	moderate database homology
`Q9LMM1`	Arabidopsis thaliana	Cytochrome P450 86A4	38.583%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card