LXL04_025793 | RubberDandelionOmics

Gene overview

LXL04_025793

Reference: OH-1004 Chr: Chr05 Coordinates: 116977633-116978856 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1224 bp · LXL04_025793|LXL04_025793|OH1004|cDNA

ATGAAACTTCCGACATGGCTATGGATATTCTCCGACGACAAAACACCCACGCCACCACCATCTAAACTCCTAATCTTCTCCGACACAACCACAATCGCAACCACCACAATCATCAGTTGCAGCCTACAAAGCAACCACTCACCGGAAACCTTAGCGTTAACCGTCTCCCACCTCCGGCTCTCTACCCTCACATCTCTCCCGGTTTCCCACGTCAACTTCCTCGCCGTCCATAACCACCGTCTTTACGCAGCCACCGGAGA...

CDS

Download CDS FASTA

1224 bp · LXL04_025793|LXL04_025793|OH1004|CDS

ATGAAACTTCCGACATGGCTATGGATATTCTCCGACGACAAAACACCCACGCCACCACCATCTAAACTCCTAATCTTCTCCGACACAACCACAATCGCAACCACCACAATCATCAGTTGCAGCCTACAAAGCAACCACTCACCGGAAACCTTAGCGTTAACCGTCTCCCACCTCCGGCTCTCTACCCTCACATCTCTCCCGGTTTCCCACGTCAACTTCCTCGCCGTCCATAACCACCGTCTTTACGCAGCCACCGGAGA...

Protein

Download Protein FASTA

407 aa · LXL04_025793|LXL04_025793|OH1004|PROTEIN

MKLPTWLWIFSDDKTPTPPPSKLLIFSDTTTIATTTIISCSLQSNHSPETLALTVSHLRLSTLTSLPVSHVNFLAVHNHRLYAATGDLINVIDTTSLALIDTFSVAGSSSGSVKSVTFSNGNIYTAHQDNKIRVWKSTENKRHKHIATLPTFEDRLLRSVLPKNYVNVRRHRKKLWVEHHDAVSGLALISDQLMCSVSWDKYLKIWRISDLRCVESIKAHDDAINAVVVAADSTIFTGSADCRIKVWGKAFRKYGLISTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025793`
TK1151 ID	TkA03G119200
OH-1004 ID	LXL04_025793
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.340 / OH-1004 89.926 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025793

Location Chr05:116977633-116978856 (+)

Description Similar to JGB: Protein JINGUBANG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26490`	Negative regulator of pollen germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025793 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0031037 myosin II filament disassembly Biological Process

GO:1903013 response to differentiation-inducing factor 1 Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005826 actomyosin contractile ring Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016905 myosin heavy chain kinase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0045159 myosin II binding Molecular Function

KEGG gene cross-reference

ana:alr3466

ath:AT2G26490

ddi:DDB_G0289115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.550

Rank 1 · LXL04_025793 · OH-1004

Cytoplasm0.307

Rank 2 · LXL04_025793 · OH-1004

Cell membrane0.123

Rank 3 · LXL04_025793 · OH-1004

Endoplasmic reticulum0.062

Rank 4 · LXL04_025793 · OH-1004

Lysosome / Vacuole0.039

Rank 5 · LXL04_025793 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25171.2Beta-prop_WDR36-Utp21_1st55-167 aa

PF24782.3WD40_MABP1-WDR62_2nd115-336 aa

PF24796.2WDR55165-247 aa

PF25174.2Beta-prop_THOC3174-359 aa

PF25391.2WD40_Gbeta174-335 aa

PF25047.1Beta-prop_TEP1_2nd176-249 aa

PF25175.2Beta-prop_WDR5178-302 aa

PF25173.2Beta-prop_WDR3_1st178-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025793	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	55	167	5.4e-11	43.1
LXL04_025793	`PF24782.3`	WD40_MABP1-WDR62_2nd	115	336	1.7e-10	41.1
LXL04_025793	`PF24796.2`	WDR55	165	247	9.9e-14	51.8
LXL04_025793	`PF25174.2`	Beta-prop_THOC3	174	359	3.2e-26	92.7
LXL04_025793	`PF25391.2`	WD40_Gbeta	174	335	5e-09	36.3
LXL04_025793	`PF25047.1`	Beta-prop_TEP1_2nd	176	249	8.3e-18	65.2
LXL04_025793	`PF25175.2`	Beta-prop_WDR5	178	302	1.2e-39	137.1
LXL04_025793	`PF25173.2`	Beta-prop_WDR3_1st	178	247	1.1e-27	97.7
LXL04_025793	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	178	292	4.4e-13	49.9
LXL04_025793	`PF24807.2`	WD40_CDC20-Fz	179	343	8.6e-18	65.4
LXL04_025793	`PF23414.2`	Beta-prop_EML_2	190	316	1.9e-11	44.5
LXL04_025793	`PF24814.2`	WD40_Prp19	191	296	1.5e-24	87.3
LXL04_025793	`PF25172.2`	Beta-prop_WDR3_2nd	191	294	4.6e-21	76.0
LXL04_025793	`PF20426.5`	NBCH_WD40	192	248	7e-12	45.6
LXL04_025793	`PF23393.3`	Beta-prop_WDR90_POC16_2nd	192	299	1.8e-07	31.4
LXL04_025793	`PF23381.2`	Beta-prop_IFT122_1st	196	250	4.1e-24	86.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48716`	Arabidopsis thaliana	Protein JINGUBANG	41.472%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card