LXL04_025790 | RubberDandelionOmics

Gene overview

LXL04_025790

Reference: OH-1004 Chr: Chr05 Coordinates: 116933096-116935420 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · LXL04_025790|LXL04_025790|OH1004|cDNA

ATGGATGACGCTCGTTTCGATCGTTTCCCGGTCAGCTTAGACCCAACCGCACAAGAATTCCGACCAACTTACTCTTTGTCTTTACCCCCACCTCATACATACTTCCCACACCCGTACCCGTACAACGTCTACAGTTCTCCTataccgccaccgccaccgccactGCCACTACCGCCGCCCGTTTATGTTGCACCCAAGCCACAGGCTCCGGCTCCAACACTCCCACCACCGTCAATCACCCCCACGCGTACGCTCCTACT...

CDS

Download CDS FASTA

1836 bp · LXL04_025790|LXL04_025790|OH1004|CDS

ATGGATGACGCTCGTTTCGATCGTTTCCCGGTCAGCTTAGACCCAACCGCACAAGAATTCCGACCAACTTACTCTTTGTCTTTACCCCCACCTCATACATACTTCCCACACCCGTACCCGTACAACGTCTACAGTTCTCCTATACCGCCACCGCCACCGCCACTGCCACTACCGCCGCCCGTTTATGTTGCACCCAAGCCACAGGCTCCGGCTCCAACACTCCCACCACCGTCAATCACCCCCACGCGTACGCTCCTACT...

Protein

Download Protein FASTA

611 aa · LXL04_025790|LXL04_025790|OH1004|PROTEIN

MDDARFDRFPVSLDPTAQEFRPTYSLSLPPPHTYFPHPYPYNVYSSPIPPPPPPLPLPPPVYVAPKPQAPAPTLPPPSITPTRTLLLSSVPSDVSESILRRELEVFGDVRAVQMERIRDGIVTVHFYDLRQSTEALHEIQEQHMQQQYRLRKHFDALTLSNFLSAPPYEYHSNAYLSPPLPPPAVGLIVGRAVWAQFTFPVSAGLPDGYNQGTIVVFNLVPDIAAGTLREIFEAYGSVKEIRGTPSKKNQRFVEFYDTRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025790`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025790

Location Chr05:116933096-116935420 (+)

Description Similar to TE1: Protein terminal ear1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61960`	Probable RNA-binding transcriptional activator that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WY46`	Probable RNA-binding protein.	No verified direct reference in this release
`Os01g0907900`	Probable RNA-binding protein.	PLASTOCHRON2 regulates leaf initiation and maturation in rice.2006 · DOI: 10.1105/tpc.105.037622
`Os02g0517531`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025790 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0016607 nuclear speck Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

dosa:Os01g0907900

dosa:Os02g0517531

zma:541683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.741

Rank 1 · LXL04_025790 · OH-1004

Cytoplasm0.256

Rank 2 · LXL04_025790 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_025790 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_025790 · OH-1004

Plastid0.024

Rank 5 · LXL04_025790 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16842.12RRM_occluded213-278 aa

PF00076.29RRM_1214-278 aa

PF04059.19RRM_2414-439 aa

PF04059.19RRM_2460-529 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025790	`PF16842.12`	RRM_occluded	213	278	2.7e-07	31.1
LXL04_025790	`PF00076.29`	RRM_1	214	278	2.7e-17	63.1
LXL04_025790	`PF04059.19`	RRM_2	414	439	3.1e-34	117.8
LXL04_025790	`PF04059.19`	RRM_2	460	529	3.1e-34	117.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4I9`	Arabidopsis thaliana	Protein MEI2-like 1	43.624%	Swiss-Prot	weak database homology
`A2WY46`	Oryza sativa subsp. indica	Protein terminal ear1 homolog	66.854%	Swiss-Prot	weak database homology
`Q0JGS5`	Oryza sativa subsp. japonica	Protein terminal ear1 homolog	66.111%	Swiss-Prot	weak database homology
`Q64M78`	Oryza sativa subsp. japonica	Protein MEI2-like 4	40.323%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card