LXL04_025769 | RubberDandelionOmics

Gene overview

LXL04_025769

Reference: OH-1004 Chr: Chr05 Coordinates: 116750267-116752922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2262 bp · LXL04_025769|LXL04_025769|OH1004|cDNA

ATGACAGTTTACAGTTGTTTTCTGTATGTAAACGGTCATCCGAACTTCTGTTATCACCTCATCATCTGCTGGTTGACTTCAATCATGGACCATTCAGAAATCGAAGAGAACTTGTTCGCACTTGGCGAACCAAAGCTACATGGAGGAATGTGCGCAACACTCTCCTTAATTTACGTCAAAATATTGGGCATCTTCCCCGACCTTGAAGCCGCCAGACCTCGCAGCACTTCAGGAATTCAAGCATTATGCTCTTTACATAT...

CDS

Download CDS FASTA

2262 bp · LXL04_025769|LXL04_025769|OH1004|CDS

ATGACAGTTTACAGTTGTTTTCTGTATGTAAACGGTCATCCGAACTTCTGTTATCACCTCATCATCTGCTGGTTGACTTCAATCATGGACCATTCAGAAATCGAAGAGAACTTGTTCGCACTTGGCGAACCAAAGCTACATGGAGGAATGTGCGCAACACTCTCCTTAATTTACGTCAAAATATTGGGCATCTTCCCCGACCTTGAAGCCGCCAGACCTCGCAGCACTTCAGGAATTCAAGCATTATGCTCTTTACATAT...

Protein

Download Protein FASTA

753 aa · LXL04_025769|LXL04_025769|OH1004|PROTEIN

MTVYSCFLYVNGHPNFCYHLIICWLTSIMDHSEIEENLFALGEPKLHGGMCATLSLIYVKILGIFPDLEAARPRSTSGIQALCSLHIALEKTKTILQHCADCSKLYLAITGDSVVLKFEKTRSALQDSLKRVEDIVPQTIGCQISDILGELEGIEFSLDPLEKQIGDEIIGLLQEGRTLNSTSDTHELETFHQAASKLNITSSRGALRERRSLKKLLEKARVEDDKRKESIVAYLLHLMRKYSKLFRSDFSDDNDSNSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025769`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025769

Location Chr05:116750267-116752922 (+)

Description Similar to PUB45: U-box domain-containing protein 45

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27910`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g24330`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g67530`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g46510`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g28830`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025769 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0070696 transmembrane receptor protein serine/threonine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G24330

ath:AT1G27910

ath:AT1G67530

ath:AT2G28830

ath:AT3G46510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_025769 · OH-1004

Nucleus0.343

Rank 2 · LXL04_025769 · OH-1004

Cell membrane0.196

Rank 3 · LXL04_025769 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_025769 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_025769 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04564.22U-box303-372 aa

PF25598.2ARM_PUB434-711 aa

PF24768.2ARM_ARMC5439-616 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025769	`PF04564.22`	U-box	303	372	3.7e-20	72.6
LXL04_025769	`PF25598.2`	ARM_PUB	434	711	3e-13	50.6
LXL04_025769	`PF24768.2`	ARM_ARMC5	439	616	9.4e-11	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7G1`	Arabidopsis thaliana	U-box domain-containing protein 45	57.513%	Swiss-Prot	strong database homology
`O48700`	Arabidopsis thaliana	U-box domain-containing protein 6	55.856%	Swiss-Prot	strong database homology
`Q9CAG5`	Arabidopsis thaliana	U-box domain-containing protein 7	54.477%	Swiss-Prot	strong database homology
`Q9SNC6`	Arabidopsis thaliana	U-box domain-containing protein 13	27.059%	Swiss-Prot	weak database homology
`Q9ZV31`	Arabidopsis thaliana	U-box domain-containing protein 12	27.314%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card