LXL04_025765 | RubberDandelionOmics

Gene overview

LXL04_025765

Reference: OH-1004 Chr: Chr05 Coordinates: 116726458-116730825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2478 bp · LXL04_025765|LXL04_025765|OH1004|cDNA

ATGGGCGGAGGAGATGTCCGGAAAACCACGAGAAACAGAGTCAAACCGCCTTCCAGCACTGTATCCGGAGAAGATCATCGCGAACTTCGTAACCGGAAAGGATTGCGGAAGGAAAGAGGCAAAGATCAACTTCGCATTTTAGATTTCACCGATGCAGATGATCAATTGCCAAGGGTTATCACGCCGTTTCCTGCTCCAAAAATCATGGACCTTGAGATGTTTCAAGGAGATCATAAGGAGAGCTTATATTGGGGAACATA...

CDS

Download CDS FASTA

2478 bp · LXL04_025765|LXL04_025765|OH1004|CDS

ATGGGCGGAGGAGATGTCCGGAAAACCACGAGAAACAGAGTCAAACCGCCTTCCAGCACTGTATCCGGAGAAGATCATCGCGAACTTCGTAACCGGAAAGGATTGCGGAAGGAAAGAGGCAAAGATCAACTTCGCATTTTAGATTTCACCGATGCAGATGATCAATTGCCAAGGGTTATCACGCCGTTTCCTGCTCCAAAAATCATGGACCTTGAGATGTTTCAAGGAGATCATAAGGAGAGCTTATATTGGGGAACATA...

Protein

Download Protein FASTA

825 aa · LXL04_025765|LXL04_025765|OH1004|PROTEIN

MGGGDVRKTTRNRVKPPSSTVSGEDHRELRNRKGLRKERGKDQLRILDFTDADDQLPRVITPFPAPKIMDLEMFQGDHKESLYWGTYRPQVYFGVRARTPESLVAGLMWLGIKDGRYFIRHVCQDGDDLHTYGWNKHSGRDYGHQVLIDHGMTLTTSFLKSKVDGSGYGGDWAFRVGVQSEKLSEEMPDSAHLFFYVADEGENALRLGRSVTEIHEKSLLAFGSRPDVSDWELHLKSTDDFEVHHVGLKTPHIHNLSDMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025765`
TK1151 ID	TkA03G120190
OH-1004 ID	LXL04_025765
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.100
Protein coverage (%)	TK1151 97.579 / OH-1004 60.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025765

Location Chr05:116726458-116730825 (-)

Description Similar to GCS1: Mannosyl-oligosaccharide glucosidase GCS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67490`	Cleaves the distal alpha 1,2-linked glucose residue from the Glc(3)Man(9)GlcNAc(2) oligosaccharide precursor.	No verified direct reference in this release
`At1g24320`	Alpha-glucosidase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025765 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0019082 viral protein processing Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0070062 extracellular exosome Cellular Component

KEGG gene cross-reference

ath:AT1G24320

ath:AT1G67490

hsa:7841

mmu:57377

rno:78947

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.552

Rank 1 · LXL04_025765 · OH-1004

Cytoplasm0.136

Rank 2 · LXL04_025765 · OH-1004

Golgi apparatus0.133

Rank 3 · LXL04_025765 · OH-1004

Lysosome / Vacuole0.120

Rank 4 · LXL04_025765 · OH-1004

Cell membrane0.101

Rank 5 · LXL04_025765 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16923.12Glyco_hydro_63N81-244 aa

PF03200.23Glyco_hydro_63322-820 aa

PF22422.3MGH1-like_GH660-808 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025765	`PF16923.12`	Glyco_hydro_63N	81	244	2.6e-40	139.6
LXL04_025765	`PF03200.23`	Glyco_hydro_63	322	820	2.4e-216	720.0
LXL04_025765	`PF22422.3`	MGH1-like_GH	660	808	4.3e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HTM3`	Arabidopsis thaliana	Mannosyl-oligosaccharide glucosidase GCS1	63.212%	Swiss-Prot	strong database homology
`Q84M89`	Arabidopsis thaliana	Alpha-glucosidase 2	59.302%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card