LXL04_025757 | RubberDandelionOmics

Gene overview

LXL04_025757

Reference: OH-1004 Chr: Chr05 Coordinates: 116654224-116654770 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

421 bp · LXL04_025757|LXL04_025757|OH1004|cDNA

CTTCTCCTTTTCTTCAGATTCAAAGGCGCAGCGGCGGCAAGAGGCGGAGATGGATCCAGATGCGGTAGCGAAGGCGTTCGTCGAGCACTACTACTCCACTTTCGATGCTAACCGCGCAGGTTTAGCTACTCTCTACCAGGAATCCTCGATGTTGACGTTTGAAGGTCAGAAGATTCAGGGATCTCAAAACATCGTAGCGAAGTTGACGTCACTCCCTTTCCAACAGTGCAAACACAGCATCACTACAGTAGATTGTCAGC...

CDS

Download CDS FASTA

372 bp · LXL04_025757|LXL04_025757|OH1004|CDS

ATGGATCCAGATGCGGTAGCGAAGGCGTTCGTCGAGCACTACTACTCCACTTTCGATGCTAACCGCGCAGGTTTAGCTACTCTCTACCAGGAATCCTCGATGTTGACGTTTGAAGGTCAGAAGATTCAGGGATCTCAAAACATCGTAGCGAAGTTGACGTCACTCCCTTTCCAACAGTGCAAACACAGCATCACTACAGTAGATTGTCAGCCTTCTGGTCCCGCCGGCGGCATGCTTGTCTTCGTCTCCGGTAACCTCCA...

Protein

Download Protein FASTA

123 aa · LXL04_025757|LXL04_025757|OH1004|PROTEIN

MDPDAVAKAFVEHYYSTFDANRAGLATLYQESSMLTFEGQKIQGSQNIVAKLTSLPFQQCKHSITTVDCQPSGPAGGMLVFVSGNLQLSGEQHALKFSQMFHLMPTPQSSFYVLNDIFRLNYA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025757`
TK1151 ID	TkA03G120370
OH-1004 ID	LXL04_025757
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025757

Location Chr05:116654224-116654770 (-)

Description Similar to NTF2B: Nuclear transport factor 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27970`	Facilitates protein transport into the nucleus.	Identification and characterization of the Arabidopsis orthologs of nuclear transport factor 2, the nuclear import factor of ran.2006 · DOI: 10.1104/pp.105.075499
`At1g27310`	Facilitates protein transport into the nucleus.	Identification and characterization of the Arabidopsis orthologs of nuclear transport factor 2, the nuclear import factor of ran.2006 · DOI: 10.1104/pp.105.075499

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0532300`	Facilitates protein transport into the nucleus.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025757 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0044613 nuclear pore central transport channel Cellular Component

GO:0031267 small GTPase binding Molecular Function

GO:0061608 nuclear import signal receptor activity Molecular Function

KEGG gene cross-reference

ago:AGOS_ADR013W

ath:AT1G27310

ath:AT1G27970

cgr:2888732

dosa:Os08g0532300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.704

Rank 1 · LXL04_025757 · OH-1004

Cytoplasm0.677

Rank 2 · LXL04_025757 · OH-1004

Mitochondrion0.077

Rank 3 · LXL04_025757 · OH-1004

Cell membrane0.064

Rank 4 · LXL04_025757 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_025757 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02136.27NTF26-120 aa

PF22602.3NXF_NTF27-37 aa

PF22602.3NXF_NTF243-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025757	`PF02136.27`	NTF2	6	120	3.1e-39	134.7
LXL04_025757	`PF22602.3`	NXF_NTF2	7	37	6.3e-14	53.1
LXL04_025757	`PF22602.3`	NXF_NTF2	43	118	6.3e-14	53.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7F5`	Arabidopsis thaliana	Nuclear transport factor 2B	88.618%	Swiss-Prot	strong database homology
`Q9FZK4`	Arabidopsis thaliana	Nuclear transport factor 2A	87.805%	Swiss-Prot	strong database homology
`Q9XJ54`	Oryza sativa subsp. japonica	Nuclear transport factor 2	66.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card