LXL04_025751 | RubberDandelionOmics

Gene overview

LXL04_025751

Reference: OH-1004 Chr: Chr05 Coordinates: 116539883-116541679 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · LXL04_025751|LXL04_025751|OH1004|cDNA

ATGAACAACAACAGCGGTCCAATATTTTCCTACTCATCGTCGTCACCATCGTCTTCAATTCCTGATATTCATTCATCGTATTTATCATTAAACATGGTGGAAAGCAATCGTGGTGATTACAGTAACTATCAGGATCAGATGGGGTTAATGGAGAAAGATCGAAACAAGTATGAAAGCTCCGACGATGTGGTGGCGGATCATGTTTCTCCGAGCAGCAGCAGCCGAGCTAACGGCGATGGTAAGGAGGTGATCATGGCGGC...

CDS

Download CDS FASTA

582 bp · LXL04_025751|LXL04_025751|OH1004|CDS

ATGAACAACAACAGCGGTCCAATATTTTCCTACTCATCGTCGTCACCATCGTCTTCAATTCCTGATATTCATTCATCGTATTTATCATTAAACATGGTGGAAAGCAATCGTGGTGATTACAGTAACTATCAGGATCAGATGGGGTTAATGGAGAAAGATCGAAACAAGTATGAAAGCTCCGACGATGTGGTGGCGGATCATGTTTCTCCGAGCAGCAGCAGCCGAGCTAACGGCGATGGTAAGGAGGTGATCATGGCGGC...

Protein

Download Protein FASTA

193 aa · LXL04_025751|LXL04_025751|OH1004|PROTEIN

MNNNSGPIFSYSSSSPSSSIPDIHSSYLSLNMVESNRGDYSNYQDQMGLMEKDRNKYESSDDVVADHVSPSSSSRANGDGKEVIMAAGKSSIRKGEKKIRKPKHAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRNYYRCTHQGCNVKKQVQRLSNDDGVVVTTYEGTHSHPIEKSTDNFEHILTQMQIYSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025751`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025751

Location Chr05:116539883-116541679 (+)

Description Similar to WRKY75: Probable WRKY transcription factor 75

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13080`	Transcription factor.	No verified direct reference in this release
`At3g01970`	Transcription factor.	No verified direct reference in this release
`At1g64000`	Transcription factor.	No verified direct reference in this release
`At5g41570`	Transcription factor.	No verified direct reference in this release
`At2g46130`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025751 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006817 phosphate ion transport Biological Process

GO:0010055 atrichoblast differentiation Biological Process

GO:0032107 regulation of response to nutrient levels Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0048527 lateral root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G64000

ath:AT2G46130

ath:AT3G01970

ath:AT5G13080

ath:AT5G41570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_025751 · OH-1004

Cytoplasm0.085

Rank 2 · LXL04_025751 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_025751 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_025751 · OH-1004

Plastid0.010

Rank 5 · LXL04_025751 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY116-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025751	`PF03106.22`	WRKY	116	173	1.7e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYA2`	Arabidopsis thaliana	Probable WRKY transcription factor 75	87.778%	Swiss-Prot	weak database homology
`Q9S763`	Arabidopsis thaliana	Probable WRKY transcription factor 45	74.157%	Swiss-Prot	weak database homology
`Q8VWQ4`	Arabidopsis thaliana	Probable WRKY transcription factor 56	61.000%	Swiss-Prot	moderate database homology
`Q9FFS3`	Arabidopsis thaliana	Probable WRKY transcription factor 24	63.265%	Swiss-Prot	moderate database homology
`Q8GY11`	Arabidopsis thaliana	Probable WRKY transcription factor 43	57.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card