LXL04_025739 | RubberDandelionOmics

Gene overview

LXL04_025739

Reference: OH-1004 Chr: Chr05 Coordinates: 116156274-116157837 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · LXL04_025739|LXL04_025739|OH1004|cDNA

ATGGCGCTCTCGTTTACATATCTGGTAAGCTTTGCTATCTACTTACTAGGTCTCTATCCATGTGTTTATATTGCTTTAATTCGATTGAACGTGCTGTTTCAGTCAAACGTTGGCTCGCTCTCAGCTCCCCGAAGTTTATCGCCGGTGAAAACCGTGCATACATCTTGTTTGAGTGCTACTAAGCTCGGTAAATCTACGTTGTTAGCATCCACGAGCTTTCTATCTAGCTCGCTGCGGCTGTCGTCTCCAACTAACCCTTT...

CDS

Download CDS FASTA

840 bp · LXL04_025739|LXL04_025739|OH1004|CDS

ATGGCGCTCTCGTTTACATATCTGGTAAGCTTTGCTATCTACTTACTAGGTCTCTATCCATGTGTTTATATTGCTTTAATTCGATTGAACGTGCTGTTTCAGTCAAACGTTGGCTCGCTCTCAGCTCCCCGAAGTTTATCGCCGGTGAAAACCGTGCATACATCTTGTTTGAGTGCTACTAAGCTCGGTAAATCTACGTTGTTAGCATCCACGAGCTTTCTATCTAGCTCGCTGCGGCTGTCGTCTCCAACTAACCCTTT...

Protein

Download Protein FASTA

279 aa · LXL04_025739|LXL04_025739|OH1004|PROTEIN

MALSFTYLVSFAIYLLGLYPCVYIALIRLNVLFQSNVGSLSAPRSLSPVKTVHTSCLSATKLGKSTLLASTSFLSSSLRLSSPTNPLSQRKSVSSAVRASAQEVATQAKVTNKVFFDISIGNPVGKLAGRVVIGLFGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLVHTGPGTVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQQTDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025739`
TK1151 ID	TkA08G342490
OH-1004 ID	LXL04_025739
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.838 / OH-1004 87.814 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025739

Location Chr05:116156274-116157837 (+)

Description Similar to PNSL5: Photosynthetic NDH subunit of lumenal location 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13120`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	Profound redox sensitivity of peptidyl-prolyl isomerase activity in Arabidopsis thylakoid lumen.2006 · DOI: 10.1016/j.febslet.2006.05.054 The cyclophilin CYP20-2 modulates the conformation of BRASSINAZOLE-RESISTANT1, which binds the promoter of FLOWERING LOCUS D to regulate flowering in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110296
`At3g62030`	PPIases accelerate the folding of proteins.	A cyclophilin links redox and light signals to cysteine biosynthesis and stress responses in chloroplasts.2008 · DOI: 10.1073/pnas.0808204105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025739 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000413 protein peptidyl-prolyl isomerization Biological Process

GO:0006457 protein folding Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009642 response to light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010275 NAD(P)H dehydrogenase complex assembly Biological Process

GO:0010555 response to mannitol Biological Process

GO:0019344 L-cysteine biosynthetic process Biological Process

GO:1904027 negative regulation of collagen fibril organization Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G62030

ath:AT5G13120

gga:396447

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_025739 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_025739 · OH-1004

Cytoplasm0.019

Rank 3 · LXL04_025739 · OH-1004

Nucleus0.016

Rank 4 · LXL04_025739 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_025739 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160.27Pro_isomerase122-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025739	`PF00160.27`	Pro_isomerase	122	274	6.5e-51	173.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS6`	Arabidopsis thaliana	Photosynthetic NDH subunit of lumenal location 5, chloroplastic	67.068%	Swiss-Prot	strong database homology
`P34791`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic	58.996%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card