LXL04_025723 | RubberDandelionOmics

Gene overview

LXL04_025723

Reference: OH-1004 Chr: Chr05 Coordinates: 115876320-115888738 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6611 bp · LXL04_025723|LXL04_025723|OH1004|cDNA

AATCGGAAATTTCTTCAAAACTCCCATTGAGGTGCTCAGACCATTATAACTCTATATCTCAAAATTTCCCAATTTTATAGAACACATCGATGGCATCATCATCGTCATCGTCTTCTTCTGCTCCAGACTTTTCTTCCCCATCTTGGAAGTATCATGTTTTTCTTAGCTTTAGAGGAGAAGATACTCGCAATACGTTTGTGGGCCATCTTTACTCGGCTTTGGAGCAAGAAGGTATCTTCACTTATAAGGACGACGAAACA...

CDS

Download CDS FASTA

6522 bp · LXL04_025723|LXL04_025723|OH1004|CDS

ATGGCATCATCATCGTCATCGTCTTCTTCTGCTCCAGACTTTTCTTCCCCATCTTGGAAGTATCATGTTTTTCTTAGCTTTAGAGGAGAAGATACTCGCAATACGTTTGTGGGCCATCTTTACTCGGCTTTGGAGCAAGAAGGTATCTTCACTTATAAGGACGACGAAACACTTCCACCAGGCGAATCGGTCCACCCAGCTCTCATGAAGGCCATTGAAGAATCGCAGATAGCCGTCATTATATTTTCGGAAAACTATGG...

Protein

Download Protein FASTA

2173 aa · LXL04_025723|LXL04_025723|OH1004|PROTEIN

MASSSSSSSSAPDFSSPSWKYHVFLSFRGEDTRNTFVGHLYSALEQEGIFTYKDDETLPPGESVHPALMKAIEESQIAVIIFSENYGDSSWCLDELLHIMKCRDTRGLIVLPIFYDVGPSEVRKQKRKYGESMAKHELENKTKVESWRKALTDASNISGWEPKHIANGHESKGIKQIVVEISQKLQRVTSSANENLIGMAGRMQCLRSKVQVGSGGVRMIGIWGVGGGGKTTLASSIYDEICTYFDCCCFLHNIREESNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025723`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025723

Location Chr05:115876320-115888738 (-)

Description Similar to ROQ1: Disease resistance protein Roq1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11170`	Putative disease resistance protein At4g11170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025723 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.395

Rank 1 · LXL04_025723 · OH-1004

Cytoplasm0.350

Rank 2 · LXL04_025723 · OH-1004

Nucleus0.314

Rank 3 · LXL04_025723 · OH-1004

Endoplasmic reticulum0.076

Rank 4 · LXL04_025723 · OH-1004

Plastid0.055

Rank 5 · LXL04_025723 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR20-195 aa

PF13676.12TIR_223-119 aa

PF00931.29NB-ARC214-361 aa

PF23282.2WHD_ROQ1434-501 aa

PF20160.5C-JID896-997 aa

PF01582.26TIR1137-1312 aa

PF13676.12TIR_21140-1237 aa

PF00931.29NB-ARC1322-1479 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025723	`PF01582.26`	TIR	20	195	3.7e-101	337.1
LXL04_025723	`PF13676.12`	TIR_2	23	119	6.5e-34	117.8
LXL04_025723	`PF00931.29`	NB-ARC	214	361	3.1e-36	125.3
LXL04_025723	`PF23282.2`	WHD_ROQ1	434	501	2.5e-36	124.4
LXL04_025723	`PF20160.5`	C-JID	896	997	2.8e-11	44.3
LXL04_025723	`PF01582.26`	TIR	1137	1312	3.7e-101	337.1
LXL04_025723	`PF13676.12`	TIR_2	1140	1237	6.5e-34	117.8
LXL04_025723	`PF00931.29`	NB-ARC	1322	1479	3.1e-36	125.3
LXL04_025723	`PF23282.2`	WHD_ROQ1	1551	1617	2.5e-36	124.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82500`	Arabidopsis thaliana	Putative disease resistance protein At4g11170	33.486%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card