LXL04_025718 | RubberDandelionOmics

Gene overview

LXL04_025718

Reference: OH-1004 Chr: Chr05 Coordinates: 115809072-115810662 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_025718|LXL04_025718|OH1004|cDNA

ATGGAAGAGCCAGGGCAACTTAAAAGGGCGTTTATTGATGCGACGGCCGGTTCTATCTCAGGAGCTATATCTCGCACAGTTACGTCGCCCCTAGATGTTATCAAAATCCGGTTTCAGGTTCAATTGGAACCAACTACTTCATTTGCATTACGTAGTAAAAATGTATATGGGGCCTCAAAATACACAGGAATGGCTCAAGCATCCAAAGACATCTTTAGAGAAGAAGGCCTTTCAGGCTTTTGGCGTGGTAATGTCCCAGC...

CDS

Download CDS FASTA

987 bp · LXL04_025718|LXL04_025718|OH1004|CDS

ATGGAAGAGCCAGGGCAACTTAAAAGGGCGTTTATTGATGCGACGGCCGGTTCTATCTCAGGAGCTATATCTCGCACAGTTACGTCGCCCCTAGATGTTATCAAAATCCGGTTTCAGGTTCAATTGGAACCAACTACTTCATTTGCATTACGTAGTAAAAATGTATATGGGGCCTCAAAATACACAGGAATGGCTCAAGCATCCAAAGACATCTTTAGAGAAGAAGGCCTTTCAGGCTTTTGGCGTGGTAATGTCCCAGC...

Protein

Download Protein FASTA

328 aa · LXL04_025718|LXL04_025718|OH1004|PROTEIN

MEEPGQLKRAFIDATAGSISGAISRTVTSPLDVIKIRFQVQLEPTTSFALRSKNVYGASKYTGMAQASKDIFREEGLSGFWRGNVPALLMVMPYTAIQFMVLHKVKTFASGSSKSEDHIHLSPYLSFMSGALAGCAATVGSYPFDLLRTILASQGEPKIYPNMRSAFVDIINTRGFRGLYAGLSPTLVEIIPYAGLQFGTYDTFKRWTMAWNIRGLSDPTWAEESLSSFQLFLCGIAAGSCAKAVCHPLDVVKKRFQIEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025718`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025718

Location Chr05:115809072-115810662 (+)

Description Similar to At5g48970: Mitochondrial thiamine diphosphate carrier 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48970`	Mitochondrial transporter that mediates uptake of thiamine diphosphate (ThDP) into mitochondria.	Identification of mitochondrial thiamin diphosphate carriers from Arabidopsis and maize.2012 · DOI: 10.1007/s10142-012-0273-4
`At3g21390`	Mitochondrial transporter that mediates uptake of thiamine diphosphate (ThDP) into mitochondria.	Identification of mitochondrial thiamin diphosphate carriers from Arabidopsis and maize.2012 · DOI: 10.1007/s10142-012-0273-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025718 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0030974 thiamine pyrophosphate transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0015234 thiamine transmembrane transporter activity Molecular Function

GO:0015297 antiporter activity Molecular Function

GO:0090422 thiamine pyrophosphate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G21390

ath:AT5G48970

bta:504418

zma:100194395

zma:103650800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.918

Rank 1 · LXL04_025718 · OH-1004

Cytoplasm0.038

Rank 2 · LXL04_025718 · OH-1004

Nucleus0.028

Rank 3 · LXL04_025718 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_025718 · OH-1004

Peroxisome0.014

Rank 5 · LXL04_025718 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr12-110 aa

PF00153.33Mito_carr121-208 aa

PF00153.33Mito_carr226-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025718	`PF00153.33`	Mito_carr	12	110	3.3e-74	245.4
LXL04_025718	`PF00153.33`	Mito_carr	121	208	3.3e-74	245.4
LXL04_025718	`PF00153.33`	Mito_carr	226	323	3.3e-74	245.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI73`	Arabidopsis thaliana	Mitochondrial thiamine diphosphate carrier 2	78.354%	Swiss-Prot	strong database homology
`Q8RXZ9`	Arabidopsis thaliana	Mitochondrial thiamine diphosphate carrier 1	72.892%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card