LXL04_025709 | RubberDandelionOmics

Gene overview

LXL04_025709

Reference: OH-1004 Chr: Chr05 Coordinates: 115641812-115642926 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · LXL04_025709|LXL04_025709|OH1004|cDNA

ATGGAACCACTATCTATGGCCGATTATGGATATACACCAAACGATGTTGATCTCCTTTATCCTCCGGCTGAGTTGGAGAAGAGGACACATAAGCTCAAACGTCTAGTTCAATCACCAAACTCTTTCTTCATGGACGTTAAATGCCTGGGCTGTTTCCACATAGCAACTGTGTTTAGCCACTCTCAGACGGTGGTTGAATGTGCCAACTGTAAGGCGGTGTTGTGTCAGCCGACTGGTGGTCGTGCCCTACTCACTGAAGG...

CDS

Download CDS FASTA

342 bp · LXL04_025709|LXL04_025709|OH1004|CDS

ATGGAACCACTATCTATGGCCGATTATGGATATACACCAAACGATGTTGATCTCCTTTATCCTCCGGCTGAGTTGGAGAAGAGGACACATAAGCTCAAACGTCTAGTTCAATCACCAAACTCTTTCTTCATGGACGTTAAATGCCTGGGCTGTTTCCACATAGCAACTGTGTTTAGCCACTCTCAGACGGTGGTTGAATGTGCCAACTGTAAGGCGGTGTTGTGTCAGCCGACTGGTGGTCGTGCCCTACTCACTGAAGG...

Protein

Download Protein FASTA

113 aa · LXL04_025709|LXL04_025709|OH1004|PROTEIN

MEPLSMADYGYTPNDVDLLYPPAELEKRTHKLKRLVQSPNSFFMDVKCLGCFHIATVFSHSQTVVECANCKAVLCQPTGGRALLTEGCSFRMKPDARPGNSCIRVTYTCQARN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025709`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025709

Location Chr05:115641812-115642926 (-)

Description Similar to RPS27B: 40S ribosomal protein S27-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61110`	May be involved in the elimination of damaged mRNA after UV irradiation.	Involvement of Arabidopsis thaliana ribosomal protein S27 in mRNA degradation triggered by genotoxic stress.1999 · DOI: 10.1093/emboj/18.2.490
`At5g47930`	Small ribosomal subunit protein eS27w.	No verified direct reference in this release
`At2g45710`	Small ribosomal subunit protein eS27z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025709 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0006412 translation Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G45710

ath:AT3G61110

ath:AT5G47930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_025709 · OH-1004

Nucleus0.469

Rank 2 · LXL04_025709 · OH-1004

Mitochondrion0.087

Rank 3 · LXL04_025709 · OH-1004

Cell membrane0.085

Rank 4 · LXL04_025709 · OH-1004

Endoplasmic reticulum0.065

Rank 5 · LXL04_025709 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01667.24Ribosomal_S27e39-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025709	`PF01667.24`	Ribosomal_S27e	39	93	6.5e-25	87.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2F1`	Arabidopsis thaliana	Small ribosomal subunit protein eS27y	81.707%	Swiss-Prot	strong database homology
`Q8L953`	Arabidopsis thaliana	Small ribosomal subunit protein eS27w	81.250%	Swiss-Prot	strong database homology
`O64650`	Arabidopsis thaliana	Small ribosomal subunit protein eS27z	81.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card