LXL04_025690 | RubberDandelionOmics

Gene overview

LXL04_025690

Reference: OH-1004 Chr: Chr05 Coordinates: 115321219-115322853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · LXL04_025690|LXL04_025690|OH1004|cDNA

ATGAAAACGACTCGACTAAACTCCCCTGTCTTCTTCTCCATTCTAATTCTCTCATTTTCTGTTTCATGGGCAGCACTATCTTCCATTCTTGATGTTACACCAGGTGAGGATTTCTTAGGCTGCATACAATCCTACTCCAACAATGTGACATCCATCTCTGAACTCGTTTTCACATCTGGCAATGCTTCTTTCTTACCCACTTGGCAAGTGCATGTCCAAAACACTAAATTCCTTAAATCTTCCACTCCTAAACCATCGGT...

CDS

Download CDS FASTA

1635 bp · LXL04_025690|LXL04_025690|OH1004|CDS

ATGAAAACGACTCGACTAAACTCCCCTGTCTTCTTCTCCATTCTAATTCTCTCATTTTCTGTTTCATGGGCAGCACTATCTTCCATTCTTGATGTTACACCAGGTGAGGATTTCTTAGGCTGCATACAATCCTACTCCAACAATGTGACATCCATCTCTGAACTCGTTTTCACATCTGGCAATGCTTCTTTCTTACCCACTTGGCAAGTGCATGTCCAAAACACTAAATTCCTTAAATCTTCCACTCCTAAACCATCGGT...

Protein

Download Protein FASTA

544 aa · LXL04_025690|LXL04_025690|OH1004|PROTEIN

MKTTRLNSPVFFSILILSFSVSWAALSSILDVTPGEDFLGCIQSYSNNVTSISELVFTSGNASFLPTWQVHVQNTKFLKSSTPKPSVIVTPVEETLVQTTLYCAKKQGYELRMRSGGHDYEGLSYIADVPFVMLDFTNMRSIDVDVGSSTAWVQAGAALGAVYYAISQKTDTLYFPAGVCPTVGVGGYMGGGGYGNLLRKYGSAADNVVDVRFMDVNGNIMNRKSMGEDLFWAIRGGGVSSFGIVLAWKLRLVPVPEKVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025690`
TK1151 ID	TkA06G045250
OH-1004 ID	LXL04_025690
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025690

Location Chr05:115321219-115322853 (-)

Description Similar to Tetrahydrocannabinolic acid synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44400`	Berberine bridge enzyme-like 26.	No verified direct reference in this release
`At5g44390`	Berberine bridge enzyme-like 25.	No verified direct reference in this release
`At2g34790`	Required for endosperm development and polar nuclei fusion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025690 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

GO:0050328 tetrahydroberberine oxidase activity Molecular Function

KEGG gene cross-reference

ag:ADY15026

ag:BAC41356

ath:AT2G34790

ath:AT5G44390

ath:AT5G44400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.458

Rank 1 · LXL04_025690 · OH-1004

Lysosome / Vacuole0.157

Rank 2 · LXL04_025690 · OH-1004

Endoplasmic reticulum0.135

Rank 3 · LXL04_025690 · OH-1004

Cytoplasm0.109

Rank 4 · LXL04_025690 · OH-1004

Cell membrane0.106

Rank 5 · LXL04_025690 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_485-221 aa

PF08031.18BBE480-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025690	`PF01565.29`	FAD_binding_4	85	221	5.5e-23	81.9
LXL04_025690	`PF08031.18`	BBE	480	535	1.9e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKU8`	Arabidopsis thaliana	Berberine bridge enzyme-like 26	43.178%	Swiss-Prot	moderate database homology
`Q9FKU9`	Arabidopsis thaliana	Berberine bridge enzyme-like 25	43.762%	Swiss-Prot	moderate database homology
`O64743`	Arabidopsis thaliana	Monolignol oxidoreductase AtBBE-like 15	42.407%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card