LXL04_025686 | RubberDandelionOmics

Gene overview

LXL04_025686

Reference: OH-1004 Chr: Chr05 Coordinates: 115235887-115237524 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1638 bp · LXL04_025686|LXL04_025686|OH1004|cDNA

ATGAAGAAGTCTCAACTAAATCCTTCTGCCTTCCTCTTAGTtctatttttttcattttctgtttCATGGGCAGCATTATCTTCCATTCTTGATGTGACACCGGGTTCTCAAGATTTCTTAGGCTGCCTACAATCCAACTCCAATAATGTCACCTCCACCTCTCAACTCACTTTTACCTATGGCAATGCTTCGTTCCTACCGACTTGGCAAGTGCATGTCCAAAATACTAGGTTCCTTAAACCTTCCACTCCTAAACCCGC...

CDS

Download CDS FASTA

1638 bp · LXL04_025686|LXL04_025686|OH1004|CDS

ATGAAGAAGTCTCAACTAAATCCTTCTGCCTTCCTCTTAGTTCTATTTTTTTCATTTTCTGTTTCATGGGCAGCATTATCTTCCATTCTTGATGTGACACCGGGTTCTCAAGATTTCTTAGGCTGCCTACAATCCAACTCCAATAATGTCACCTCCACCTCTCAACTCACTTTTACCTATGGCAATGCTTCGTTCCTACCGACTTGGCAAGTGCATGTCCAAAATACTAGGTTCCTTAAACCTTCCACTCCTAAACCCGC...

Protein

Download Protein FASTA

545 aa · LXL04_025686|LXL04_025686|OH1004|PROTEIN

MKKSQLNPSAFLLVLFFSFSVSWAALSSILDVTPGSQDFLGCLQSNSNNVTSTSQLTFTYGNASFLPTWQVHVQNTRFLKPSTPKPAVIVTPVDETLVQTTLYCAKKHGYELRIRSGGHDYEGLSYTADVPFVMLDFTNMRSIDVDVANQTAWVQAGAALGALYYAISQKTDTLYFPSGVCPTVGVGGYMGGAGYGNLLRKYGTAADNVLDVRFMDVNGNVLDRASMGEDLFWAIRGGGASSFGIVLAWKLRLVPVPEKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025686`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025686

Location Chr05:115235887-115237524 (-)

Description Similar to Tetrahydrocannabinolic acid synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44390`	Berberine bridge enzyme-like 25.	No verified direct reference in this release
`At1g30760`	Mediates oxidation of p-hydroxylated derivatives of cinnamyl alcohol (i.e. the monolignols p-coumaryl-, coniferyl-, and sinapyl alcohol) to their corresponding aldehydes.	No verified direct reference in this release
`At2g34790`	Required for endosperm development and polar nuclei fusion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025686 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:ADY15026

ag:BAC41356

ath:AT1G30760

ath:AT2G34790

ath:AT5G44390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.419

Rank 1 · LXL04_025686 · OH-1004

Lysosome / Vacuole0.181

Rank 2 · LXL04_025686 · OH-1004

Endoplasmic reticulum0.147

Rank 3 · LXL04_025686 · OH-1004

Cytoplasm0.125

Rank 4 · LXL04_025686 · OH-1004

Cell membrane0.108

Rank 5 · LXL04_025686 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_486-222 aa

PF08031.18BBE481-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025686	`PF01565.29`	FAD_binding_4	86	222	5e-25	88.5
LXL04_025686	`PF08031.18`	BBE	481	536	1.9e-16	60.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKU9`	Arabidopsis thaliana	Berberine bridge enzyme-like 25	44.238%	Swiss-Prot	moderate database homology
`Q93ZA3`	Arabidopsis thaliana	Monolignol oxidoreductase AtBBE-like 13	44.685%	Swiss-Prot	moderate database homology
`O64743`	Arabidopsis thaliana	Monolignol oxidoreductase AtBBE-like 15	43.173%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card