LXL04_025672 | RubberDandelionOmics

Gene overview

LXL04_025672

Reference: OH-1004 Chr: Chr05 Coordinates: 115064278-115068947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1704 bp · LXL04_025672|LXL04_025672|OH1004|cDNA

ATGACTATGGCAACTGGTGTTCTCTCCCTTGGCTTGCTCTACAGTTTCTCCGTCAATTTCTATTCTGGGATTTCTCAGTTCAATCTTTCAATCGCAGACGGAGAATTTGTGAAAAATGGCTGTTTGAGTTTTGATGTTTTTAGGGTTGCTTCTGCTCCTGGAAAGGTTTTGATGACTGGTGGTTATCTGGTATTGGAGAGGCCCAATGCAGGAATCGTGCTCAGTACAAACGCTCGATTTTATGCAATTCTCAAGCCACT...

CDS

Download CDS FASTA

1704 bp · LXL04_025672|LXL04_025672|OH1004|CDS

ATGACTATGGCAACTGGTGTTCTCTCCCTTGGCTTGCTCTACAGTTTCTCCGTCAATTTCTATTCTGGGATTTCTCAGTTCAATCTTTCAATCGCAGACGGAGAATTTGTGAAAAATGGCTGTTTGAGTTTTGATGTTTTTAGGGTTGCTTCTGCTCCTGGAAAGGTTTTGATGACTGGTGGTTATCTGGTATTGGAGAGGCCCAATGCAGGAATCGTGCTCAGTACAAACGCTCGATTTTATGCAATTCTCAAGCCACT...

Protein

Download Protein FASTA

567 aa · LXL04_025672|LXL04_025672|OH1004|PROTEIN

MTMATGVLSLGLLYSFSVNFYSGISQFNLSIADGEFVKNGCLSFDVFRVASAPGKVLMTGGYLVLERPNAGIVLSTNARFYAILKPLYDAVGSDDLVVEWMEVKVNSPQMSRETTYKMSLKDFTLQCSRQVESRNPFVEYAVQYSIAAAYATLDKNKRTELQKLLSQGMDITILGSNDFYSYRNQIEARGLPLVPESLASLPPFTSITFNSEDSNEEKNTKPEVAKTGLGSSAAMTTAVVAALLNYLGVVDLLTSSKNQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025672`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025672

Location Chr05:115064278-115068947 (+)

Description Similar to PMK: Phosphomevalonate kinase, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31910`	Phosphomevalonate kinase, peroxisomal.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006696 ergosterol biosynthetic process Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0031388 organic acid phosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004631 phosphomevalonate kinase activity Molecular Function

KEGG gene cross-reference

afm:AFUA_5G10680

ath:AT1G31910

fgr:FGSG_09764

sce:YMR220W

spo:2543184

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.764

Rank 1 · LXL04_025672 · OH-1004

Nucleus0.350

Rank 2 · LXL04_025672 · OH-1004

Mitochondrion0.086

Rank 3 · LXL04_025672 · OH-1004

Peroxisome0.085

Rank 4 · LXL04_025672 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_025672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00288.33GHMP_kinases_N226-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025672	`PF00288.33`	GHMP_kinases_N	226	297	6.6e-08	33.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6T1`	Arabidopsis thaliana	Phosphomevalonate kinase, peroxisomal	65.571%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card