LXL04_025651 | RubberDandelionOmics

Gene overview

LXL04_025651

Reference: OH-1004 Chr: Chr05 Coordinates: 114754363-114763204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4413 bp · LXL04_025651|LXL04_025651|OH1004|cDNA

ATGGCTGATACAGCCATACAGCTAACTTGGGATATTGCACCTCATAACAACCCTACTGCAACCTCCTTTCATGCGCTTCTTCCTTTCAGAATTCAGAGTTTATACAGTCAAATAGACATGGAGCACACTCAAGAGCTCGAAAATGGTGATCGAACGACAAAAAGCAATCAAAATCTTCTGGAGGAGGAAGCAGAAGTGGCTGATGAATCAAAGGGAAAAGAAATAGAGTCGGTAGAGATGGTATTTAGGGACACGATGGT...

CDS

Download CDS FASTA

4413 bp · LXL04_025651|LXL04_025651|OH1004|CDS

ATGGCTGATACAGCCATACAGCTAACTTGGGATATTGCACCTCATAACAACCCTACTGCAACCTCCTTTCATGCGCTTCTTCCTTTCAGAATTCAGAGTTTATACAGTCAAATAGACATGGAGCACACTCAAGAGCTCGAAAATGGTGATCGAACGACAAAAAGCAATCAAAATCTTCTGGAGGAGGAAGCAGAAGTGGCTGATGAATCAAAGGGAAAAGAAATAGAGTCGGTAGAGATGGTATTTAGGGACACGATGGT...

Protein

Download Protein FASTA

1470 aa · LXL04_025651|LXL04_025651|OH1004|PROTEIN

MADTAIQLTWDIAPHNNPTATSFHALLPFRIQSLYSQIDMEHTQELENGDRTTKSNQNLLEEEAEVADESKGKEIESVEMVFRDTMVPSWKGQLTVRAFVVSAILGVVFSFIVMKLNLTTGIIPSLNVAAGLLGFFFVKTWTKALEHCGLLKHPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSDTVAAQSSDANSPLRSMNIKNPSLSWMIGFLFIVSFIGLCSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025651`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025651

Location Chr05:114754363-114763204 (+)

Description Similar to YSL7: Probable metal-nicotianamine transporter YSL7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65730`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`At3g17650`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0524600`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`Os02g0633300`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release
`Os04g0674600`	May be involved in the transport of nicotianamine-chelated metals.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025651 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0035673 oligopeptide transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G65730

dosa:Os04g0524600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.526

Rank 1 · LXL04_025651 · OH-1004

Lysosome / Vacuole0.219

Rank 2 · LXL04_025651 · OH-1004

Endoplasmic reticulum0.128

Rank 3 · LXL04_025651 · OH-1004

Cytoplasm0.079

Rank 4 · LXL04_025651 · OH-1004

Golgi apparatus0.051

Rank 5 · LXL04_025651 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03169.21OPT93-717 aa

PF03169.21OPT819-1439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025651	`PF03169.21`	OPT	93	717		1066.1
LXL04_025651	`PF03169.21`	OPT	819	1439		1066.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHY2`	Arabidopsis thaliana	Probable metal-nicotianamine transporter YSL7	68.970%	Swiss-Prot	weak database homology
`Q9LUN2`	Arabidopsis thaliana	Probable metal-nicotianamine transporter YSL5	67.701%	Swiss-Prot	weak database homology
`Q5JQD7`	Oryza sativa subsp. japonica	Probable metal-nicotianamine transporter YSL12	71.407%	Swiss-Prot	weak database homology
`Q6H7J6`	Oryza sativa subsp. japonica	Probable metal-nicotianamine transporter YSL14	70.448%	Swiss-Prot	weak database homology
`Q0J932`	Oryza sativa subsp. japonica	Probable metal-nicotianamine transporter YSL10	66.618%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card