LXL04_025648 | RubberDandelionOmics

Gene overview

LXL04_025648

Reference: OH-1004 Chr: Chr05 Coordinates: 114697075-114700368 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · LXL04_025648|LXL04_025648|OH1004|cDNA

ATGGGGAAATCAGCTAAGAAATCTGCCTCCAAGGTTGAGTCAGCTCCTGCTGTCGTAGCGCCCACCAAATCAATGAAAAAAGGCAAGAGAGACGCCGAGGAGATTGTCGTGAAGGAAGTAGTGAGTAGCAAGAAGCAGAAGGTAGTCAACGGTGCTGTTACTCAGGCTATTGAGAAGAAGAAGGTCGAGACTAAAACCCAAAAGAAGAACGTCAAGAAGCAAGAAAGCAGTTCTTCTGAAGAAGACTCAGACTCTGATGA...

CDS

Download CDS FASTA

1881 bp · LXL04_025648|LXL04_025648|OH1004|CDS

ATGGGGAAATCAGCTAAGAAATCTGCCTCCAAGGTTGAGTCAGCTCCTGCTGTCGTAGCGCCCACCAAATCAATGAAAAAAGGCAAGAGAGACGCCGAGGAGATTGTCGTGAAGGAAGTAGTGAGTAGCAAGAAGCAGAAGGTAGTCAACGGTGCTGTTACTCAGGCTATTGAGAAGAAGAAGGTCGAGACTAAAACCCAAAAGAAGAACGTCAAGAAGCAAGAAAGCAGTTCTTCTGAAGAAGACTCAGACTCTGATGA...

Protein

Download Protein FASTA

626 aa · LXL04_025648|LXL04_025648|OH1004|PROTEIN

MGKSAKKSASKVESAPAVVAPTKSMKKGKRDAEEIVVKEVVSSKKQKVVNGAVTQAIEKKKVETKTQKKNVKKQESSSSEEDSDSDEEPKKVVAPAKKAAPVAKKPVKESSSDDSDSSSDEEPQPKKQSAPAAKKVPITKPESSSDESESDDSDSSDDEEAKKPAVPAKNGAVAAKKAESSDESDSDDSSDEEDAKAAKKPAVVKNGAGATPAKKAESSDDSSSEESDSEEEVKAAPAAKKPAPVAAAKKAESSDESSEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025648`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025648

Location Chr05:114697075-114700368 (-)

Description Similar to NUCL2: Nucleolin 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18610`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release
`At1g48920`	Involved in pre-rRNA processing and ribosome assembly.	Arabidopsis nucleolin affects plant development and patterning.2007 · DOI: 10.1104/pp.106.093575

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0620700`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release
`Os08g0192900`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025648 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0048367 shoot system development Biological Process

KEGG gene cross-reference

ath:AT1G48920

ath:AT3G18610

dosa:Os04g0620700

dosa:Os08g0192900

hsa:55147

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · LXL04_025648 · OH-1004

Cytoplasm0.167

Rank 2 · LXL04_025648 · OH-1004

Extracellular0.032

Rank 3 · LXL04_025648 · OH-1004

Cell membrane0.026

Rank 4 · LXL04_025648 · OH-1004

Mitochondrion0.018

Rank 5 · LXL04_025648 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1369-436 aa

PF00076.29RRM_1480-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025648	`PF00076.29`	RRM_1	369	436	6.2e-27	94.0
LXL04_025648	`PF00076.29`	RRM_1	480	536	6.2e-27	94.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PEP5`	Arabidopsis thaliana	Nucleolin 2	45.608%	Swiss-Prot	weak database homology
`Q9FVQ1`	Arabidopsis thaliana	Nucleolin 1	48.858%	Swiss-Prot	weak database homology
`Q7XTT4`	Oryza sativa subsp. japonica	Nucleolin 2	53.333%	Swiss-Prot	weak database homology
`Q6Z1C0`	Oryza sativa subsp. japonica	Nucleolin 1	49.746%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card