LXL04_025641 | RubberDandelionOmics

Gene overview

LXL04_025641

Reference: OH-1004 Chr: Chr05 Coordinates: 114642235-114647534 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3753 bp · LXL04_025641|LXL04_025641|OH1004|cDNA

ATGGCTCCTGGGCGGAAACGTGGAGGAGCAAAAGGAGCCAAAACAAAGAGTCAGTTAAATTTGGGCGATCTTGTTCTCGCTAAGGTCAAGGGTTTTCCTGCATGGCCTGCCAAGGCTGTGGATGGTGGTATACTTCTGGATTTTATTTTGGTGATCAGTAGACCTGAAGATTGGGAACGAGCTCCTGATCCAAAAAAATATTTTGTACAGTTCTTTGGTACCGAAGAAATAGCTTTTGTAGCTCCAGTTGATATTCAACC...

CDS

Download CDS FASTA

3753 bp · LXL04_025641|LXL04_025641|OH1004|CDS

ATGGCTCCTGGGCGGAAACGTGGAGGAGCAAAAGGAGCCAAAACAAAGAGTCAGTTAAATTTGGGCGATCTTGTTCTCGCTAAGGTCAAGGGTTTTCCTGCATGGCCTGCCAAGGCTGTGGATGGTGGTATACTTCTGGATTTTATTTTGGTGATCAGTAGACCTGAAGATTGGGAACGAGCTCCTGATCCAAAAAAATATTTTGTACAGTTCTTTGGTACCGAAGAAATAGCTTTTGTAGCTCCAGTTGATATTCAACC...

Protein

Download Protein FASTA

1250 aa · LXL04_025641|LXL04_025641|OH1004|PROTEIN

MAPGRKRGGAKGAKTKSQLNLGDLVLAKVKGFPAWPAKAVDGGILLDFILVISRPEDWERAPDPKKYFVQFFGTEEIAFVAPVDIQPFTSESKNKLLDRCKGKTVKYFSQAVKEICGIFEDLQNKSSDSLKDGTDGQSSQPDANSTEMVDDAMTTESYNDIVNHGPGLERCSHIHREREMGHEDMKPSVSPFVNDCSPSKKRIELSNDEVTSPNKNPTSGLKVETNGQKSNKIERASKKRHDGDDGLNKMHSPAQTNHLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025641`
TK1151 ID	TkA06G047640
OH-1004 ID	LXL04_025641
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 96.051 / OH-1004 61.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025641

Location Chr05:114642235-114647534 (+)

Description Similar to HULK1: Protein HUA2-LIKE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08230`	Probable transcription factor that acts with partial redundancy with HULK2 and HULK3.	A plant-specific HUA2-LIKE (HULK) gene family in Arabidopsis thaliana is essential for development.2014 · DOI: 10.1111/tpj.12629
`At3g63070`	Probable transcription factor that acts with partial redundancy with HULK1 and HULK2.	A plant-specific HUA2-LIKE (HULK) gene family in Arabidopsis thaliana is essential for development.2014 · DOI: 10.1111/tpj.12629
`At2g48160`	Probable transcription factor that acts with partial redundancy with HULK1 and HULK3.	A plant-specific HUA2-LIKE (HULK) gene family in Arabidopsis thaliana is essential for development.2014 · DOI: 10.1111/tpj.12629

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025641 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009908 flower development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G48160

ath:AT3G63070

ath:AT5G08230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · LXL04_025641 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_025641 · OH-1004

Cell membrane0.042

Rank 3 · LXL04_025641 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_025641 · OH-1004

Plastid0.014

Rank 5 · LXL04_025641 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00855.24PWWP22-116 aa

PF12243.15CTK3709-829 aa

PF04818.20CID711-834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025641	`PF00855.24`	PWWP	22	116	1.5e-16	61.3
LXL04_025641	`PF12243.15`	CTK3	709	829	1.6e-08	35.4
LXL04_025641	`PF04818.20`	CID	711	834	3.7e-14	53.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEY4`	Arabidopsis thaliana	Protein HUA2-LIKE 1	48.310%	Swiss-Prot	weak database homology
`F4IZM8`	Arabidopsis thaliana	Protein HUA2-LIKE 3	43.149%	Swiss-Prot	weak database homology
`F4IN78`	Arabidopsis thaliana	Protein HUA2-LIKE 2	48.235%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card