Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2343 bp · LXL04_025611|LXL04_025611|OH1004|cDNA
ATGCGCGGCTTATTAACCCTTAAGAGGCGTATCTCCATCTTTACAATCCAATCTTCCTGTAACCCGCAAAGGTTCTACAGCTCGCACTTTGATTTACGGGATGTAAACACTGTAACTGTTGCTCTCAATTCGGCGGAGAGTCGGAGATTACCTATTCTTGGAACCCAGATTCATGGTCATATAATCAAGCTCGGGTTATCAAATGACATCTACACTCAAAACAATTTAGTGAAATTGTACATGAATTGTGGGATGTTCAG...
2343 bp · LXL04_025611|LXL04_025611|OH1004|CDS
ATGCGCGGCTTATTAACCCTTAAGAGGCGTATCTCCATCTTTACAATCCAATCTTCCTGTAACCCGCAAAGGTTCTACAGCTCGCACTTTGATTTACGGGATGTAAACACTGTAACTGTTGCTCTCAATTCGGCGGAGAGTCGGAGATTACCTATTCTTGGAACCCAGATTCATGGTCATATAATCAAGCTCGGGTTATCAAATGACATCTACACTCAAAACAATTTAGTGAAATTGTACATGAATTGTGGGATGTTCAG...
Protein
Download Protein FASTA780 aa · LXL04_025611|LXL04_025611|OH1004|PROTEIN
MRGLLTLKRRISIFTIQSSCNPQRFYSSHFDLRDVNTVTVALNSAESRRLPILGTQIHGHIIKLGLSNDIYTQNNLVKLYMNCGMFSYARKLFDEMPERNLVSWTLIISGANKISNYEVALQLFINMTRTESFMPNEFALGSIMKAGINTGALEFCLCIHCFSIKIGLEKNNFVGSSILHMYSKYGDIKSAESLFESLNVGSDLACWNAMVGGYAQCGYGFEAKKTVSLMHLKRVVIDELTFIHALNASSITCDMDFGSQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025611 |
|---|---|
| TK1151 ID | TkA06G049260 |
| OH-1004 ID | LXL04_025611 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 90.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 33.974Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025611 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:114235917-114238259 (-) | ||||||||||||||||||
| Description | Similar to PCMP-E88: Pentatricopeptide repeat-containing protein At3g09040, mitochondrial | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0009451 RNA modification Biological Process GO:0005739 mitochondrion Cellular Component GO:0003723 RNA binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G09040 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13041.13PPR_2402-446 aaPF12854.14PPR_1598-627 aaPF13041.13PPR_2599-646 aaPF13812.13PPR_3599-645 aaPF01535.27PPR603-628 aaPF20431.5E_motif716-778 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025611 | PF13041.13 | PPR_2 | 402 | 446 | 2.9e-55 | 184.9 |
| LXL04_025611 | PF12854.14 | PPR_1 | 598 | 627 | 7.2e-24 | 83.9 |
| LXL04_025611 | PF13041.13 | PPR_2 | 599 | 646 | 2.9e-55 | 184.9 |
| LXL04_025611 | PF13812.13 | PPR_3 | 599 | 645 | 1.4e-20 | 73.9 |
| LXL04_025611 | PF01535.27 | PPR | 603 | 628 | 2.2e-42 | 141.1 |
| LXL04_025611 | PF20431.5 | E_motif | 716 | 778 | 2.5e-11 | 44.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9SS83 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At3g09040, mitochondrial | 32.497% | Swiss-Prot | moderate database homology |
Q9SVA5 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At4g39530 | 32.524% | Swiss-Prot | moderate database homology |
Q9SVP7 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At4g13650 | 29.700% | Swiss-Prot | weak database homology |
Q9SVH0 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At4g20770 | 30.418% | Swiss-Prot | moderate database homology |
Q9STE1 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At4g21300 | 28.571% | Swiss-Prot | weak database homology |