LXL04_025585 | RubberDandelionOmics

Gene overview

LXL04_025585

Reference: OH-1004 Chr: Chr05 Coordinates: 113842508-113843782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · LXL04_025585|LXL04_025585|OH1004|cDNA

ATGGATCCATCGGAGCTACAAACTCTGTACACTATCATGGAAACTCTCTCTCTAGACCAAAAATGGAGACTCAGCTATCCAAACCCATGTAAACCTTCCGCTTCTTGGGTTGGAATAGAATGCAAACGAGGTGTTACAGACTCTCATCTTCATGTCACTAGGCTTAATTTCGGTACCCCACCTAACCCTACGTGCAAGAACACTGCTAGTTTCCCTTCAGAAATCTTTAACCTTCCTTACCTTCAGTCTATCTTCTTCTT...

CDS

Download CDS FASTA

1275 bp · LXL04_025585|LXL04_025585|OH1004|CDS

ATGGATCCATCGGAGCTACAAACTCTGTACACTATCATGGAAACTCTCTCTCTAGACCAAAAATGGAGACTCAGCTATCCAAACCCATGTAAACCTTCCGCTTCTTGGGTTGGAATAGAATGCAAACGAGGTGTTACAGACTCTCATCTTCATGTCACTAGGCTTAATTTCGGTACCCCACCTAACCCTACGTGCAAGAACACTGCTAGTTTCCCTTCAGAAATCTTTAACCTTCCTTACCTTCAGTCTATCTTCTTCTT...

Protein

Download Protein FASTA

424 aa · LXL04_025585|LXL04_025585|OH1004|PROTEIN

MDPSELQTLYTIMETLSLDQKWRLSYPNPCKPSASWVGIECKRGVTDSHLHVTRLNFGTPPNPTCKNTASFPSEIFNLPYLQSIFFFQCFTITKTMISVSKISGPSSLQQLSFRSNPSLVGSIPSQLFSHLSSLQILTISQSRISGRIPPEISTMGSLVHLDLSYNQLTGAIPVELSKLRKLVGLDLSYNSLTGQIPNAIGQLGMLQKLDFSSNLLTGSVPESVGKLTSLAFIALSNNGLHGKPPVGLANLKGLEYLIME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025585`
TK1151 ID	TkA06G050110
OH-1004 ID	LXL04_025585
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 57.000 / OH-1004 13.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025585

Location Chr05:113842508-113843782 (-)

Description Similar to RLP29: Receptor like protein 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42800`	Receptor like protein 29.	No verified direct reference in this release
`At1g80080`	Promotes cell fate progression in stomatal development.	No verified direct reference in this release
`At1g13230`	Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At5g07280`	Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025585 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010376 stomatal complex formation Biological Process

KEGG gene cross-reference

ath:AT1G13230

ath:AT1G80080

ath:AT2G42800

ath:AT4G28650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.812

Rank 1 · LXL04_025585 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_025585 · OH-1004

Cytoplasm0.073

Rank 3 · LXL04_025585 · OH-1004

Extracellular0.053

Rank 4 · LXL04_025585 · OH-1004

Nucleus0.048

Rank 5 · LXL04_025585 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8108-168 aa

PF13855.13LRR_8154-192 aa

PF13855.13LRR_8157-216 aa

PF12799.14LRR_4157-193 aa

PF23598.2LRR_14176-258 aa

PF13855.13LRR_8185-240 aa

PF13855.13LRR_8206-263 aa

PF13855.13LRR_8233-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025585	`PF13855.13`	LRR_8	108	168	1.5e-28	99.0
LXL04_025585	`PF13855.13`	LRR_8	154	192	1.5e-28	99.0
LXL04_025585	`PF13855.13`	LRR_8	157	216	1.5e-28	99.0
LXL04_025585	`PF12799.14`	LRR_4	157	193	2.2e-19	69.7
LXL04_025585	`PF23598.2`	LRR_14	176	258	8.6e-19	68.2
LXL04_025585	`PF13855.13`	LRR_8	185	240	1.5e-28	99.0
LXL04_025585	`PF13855.13`	LRR_8	206	263	1.5e-28	99.0
LXL04_025585	`PF13855.13`	LRR_8	233	285	1.5e-28	99.0
LXL04_025585	`PF23598.2`	LRR_14	248	333	8.6e-19	68.2
LXL04_025585	`PF13855.13`	LRR_8	276	336	1.5e-28	99.0
LXL04_025585	`PF12799.14`	LRR_4	301	336	2.2e-19	69.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJH6`	Arabidopsis thaliana	Receptor like protein 29	62.663%	Swiss-Prot	strong database homology
`Q9SSD1`	Arabidopsis thaliana	Protein TOO MANY MOUTHS	34.856%	Swiss-Prot	moderate database homology
`Q5PP26`	Arabidopsis thaliana	Piriformospora indica-insensitive protein 2	33.249%	Swiss-Prot	moderate database homology
`Q9M0G7`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 1	38.652%	Swiss-Prot	moderate database homology
`Q9LYN8`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase EMS1	39.273%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card