LXL04_025573 | RubberDandelionOmics

Gene overview

LXL04_025573

Reference: OH-1004 Chr: Chr05 Coordinates: 113714756-113716658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1356 bp · LXL04_025573|LXL04_025573|OH1004|cDNA

ATGATGAAACCTACGGTCATCATGGTGCCCTACCCAGCACAAGGCCACGTAACACCCATGCTCAACCTCGCCTCCGCCGTGAGCCGCCTTGGCCTTTCTCCGGTGGTTGTTACACCGGAATTCATCCACAAAACCATCGCTCACAAAAACACCAACATCACCTGCATGTCTATTCCGGACGGTTTGGAGGATGAGACCCCACGTGATTTCTTCTCGATTGAGTTTGCGATGGAGAACAACATGTCGGTGCATTTGGAAAA...

CDS

Download CDS FASTA

1356 bp · LXL04_025573|LXL04_025573|OH1004|CDS

ATGATGAAACCTACGGTCATCATGGTGCCCTACCCAGCACAAGGCCACGTAACACCCATGCTCAACCTCGCCTCCGCCGTGAGCCGCCTTGGCCTTTCTCCGGTGGTTGTTACACCGGAATTCATCCACAAAACCATCGCTCACAAAAACACCAACATCACCTGCATGTCTATTCCGGACGGTTTGGAGGATGAGACCCCACGTGATTTCTTCTCGATTGAGTTTGCGATGGAGAACAACATGTCGGTGCATTTGGAAAA...

Protein

Download Protein FASTA

451 aa · LXL04_025573|LXL04_025573|OH1004|PROTEIN

MMKPTVIMVPYPAQGHVTPMLNLASAVSRLGLSPVVVTPEFIHKTIAHKNTNITCMSIPDGLEDETPRDFFSIEFAMENNMSVHLENLVREINGGDSGGVAFMIVDLLASWALKVGGDCGVPVVGYWPVMFAAYQLIAAIPEMLSLGIISETGIPQNEGPIYLGYDQPPLGTQDLPWLIGNLVSRKSRFKFWTRTLSRTRTLSQILVNTFPEEHHIDTNLQDQSIKYPNITPIGPLTQHTRYRNPRFLEKDTSCLEWLDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025573`
TK1151 ID	TkA06G050940
OH-1004 ID	LXL04_025573
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 54.989 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025573

Location Chr05:113714756-113716658 (-)

Description Similar to UGT82A1: UDP-glycosyltransferase 82A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22250`	UDP-glycosyltransferase 82A1.	No verified direct reference in this release
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release
`At5g59590`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At3g46660`	Possesses quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At3g46670`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025573 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02100

ath:AT3G22250

ath:AT3G46660

ath:AT3G46670

ath:AT5G59590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_025573 · OH-1004

Plastid0.179

Rank 2 · LXL04_025573 · OH-1004

Peroxisome0.171

Rank 3 · LXL04_025573 · OH-1004

Nucleus0.146

Rank 4 · LXL04_025573 · OH-1004

Mitochondrion0.084

Rank 5 · LXL04_025573 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT250-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025573	`PF00201.25`	UDPGT	250	409	2.9e-23	83.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHJ2`	Arabidopsis thaliana	UDP-glycosyltransferase 82A1	49.781%	Swiss-Prot	moderate database homology
`Q9SGA8`	Arabidopsis thaliana	UDP-glycosyltransferase 83A1	29.424%	Swiss-Prot	weak database homology
`Q9LTH2`	Arabidopsis thaliana	UDP-glycosyltransferase 76E2	30.137%	Swiss-Prot	moderate database homology
`Q94AB5`	Arabidopsis thaliana	Flavonol 3-O-glucosyltransferase UGT76E12	29.062%	Swiss-Prot	weak database homology
`Q9SNB1`	Arabidopsis thaliana	UDP-glycosyltransferase 76E11	28.571%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card