LXL04_025571 | RubberDandelionOmics

Gene overview

LXL04_025571

Reference: OH-1004 Chr: Chr05 Coordinates: 113706234-113707980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_025571|LXL04_025571|OH1004|cDNA

ATGACGATGAAAGAGTGGAAATTCAAAGAGAATCAGAATTTAAAGACTGCATCAGCCTTTTCAATTAAACGTGTTCTTGACGATGTCAAGAACAACGTTAATCCAAGTGATGAAAGGCCCGTTATACCTTTCAGCCATGGAGATCCTTCATCGTTTTCATGCTTCCGAACTACTCAAGTAGCAGAAGATGCAGTAGTGGATGCTCTTTGCTCAGCTAACTTCAACGGTTATGCACCCAAAGGCGGCGCTCTTCAAGCAAG...

CDS

Download CDS FASTA

1251 bp · LXL04_025571|LXL04_025571|OH1004|CDS

ATGACGATGAAAGAGTGGAAATTCAAAGAGAATCAGAATTTAAAGACTGCATCAGCCTTTTCAATTAAACGTGTTCTTGACGATGTCAAGAACAACGTTAATCCAAGTGATGAAAGGCCCGTTATACCTTTCAGCCATGGAGATCCTTCATCGTTTTCATGCTTCCGAACTACTCAAGTAGCAGAAGATGCAGTAGTGGATGCTCTTTGCTCAGCTAACTTCAACGGTTATGCACCCAAAGGCGGCGCTCTTCAAGCAAG...

Protein

Download Protein FASTA

416 aa · LXL04_025571|LXL04_025571|OH1004|PROTEIN

MTMKEWKFKENQNLKTASAFSIKRVLDDVKNNVNPSDERPVIPFSHGDPSSFSCFRTTQVAEDAVVDALCSANFNGYAPKGGALQARRAIAEYLSINLPYELSTDDVYVTLGAKQAIEIVLSSLRRPGANILLPKPGYPAYDALSILNHIEVRHFDLLQEKTWEVDLEGVEKLADDKTVAMVIINPGNPCGNVFTHAHLQKIAETARRLGILVIADEAYAHLTFGRNSFVPMGVFGSIVPILTLGSLSKRWIVPGWRLGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025571`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025571

Location Chr05:113706234-113707980 (+)

Description Similar to NAAT1: Nicotianamine aminotransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36160`	Transaminase involved in tyrosine breakdown.	Identification and Partial Characterization of an L-Tyrosine Aminotransferase (TAT) from Arabidopsis thaliana.2010 · DOI: 10.1155/2010/549572
`At5g53970`	Probable aminotransferase TAT2.	No verified direct reference in this release
`At2g20610`	C-S lyase involved in glucosinolate biosynthesis.	Arabidopsis mutants in the C-S lyase of glucosinolate biosynthesis establish a critical role for indole-3-acetaldoxime in auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02002.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0306401`	Involved in biosynthesis of mugineic acid family phytosiderophores, which are ferric iron chelators produced in graminaceous plants in response to iron deficiency.	Identification and localisation of the rice nicotianamine aminotransferase gene OsNAAT1 expression suggests the site of phytosiderophore synthesis in rice.2008 · DOI: 10.1007/s11103-007-9262-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025571 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001560 regulation of cell growth by extracellular stimulus Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006559 L-phenylalanine catabolic process Biological Process

GO:0006572 L-tyrosine catabolic process Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0048830 adventitious root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G20610

ath:AT5G36160

ath:AT5G53970

dosa:Os02g0306401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · LXL04_025571 · OH-1004

Nucleus0.174

Rank 2 · LXL04_025571 · OH-1004

Endoplasmic reticulum0.087

Rank 3 · LXL04_025571 · OH-1004

Peroxisome0.066

Rank 4 · LXL04_025571 · OH-1004

Mitochondrion0.060

Rank 5 · LXL04_025571 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155.28Aminotran_1_240-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025571	`PF00155.28`	Aminotran_1_2	40	405	9e-55	187.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVY1`	Arabidopsis thaliana	Tyrosine aminotransferase	53.027%	Swiss-Prot	strong database homology
`Q9FN30`	Arabidopsis thaliana	Probable aminotransferase TAT2	54.950%	Swiss-Prot	strong database homology
`Q9SIV0`	Arabidopsis thaliana	S-alkyl-thiohydroximate lyase SUR1	50.976%	Swiss-Prot	strong database homology
`A0A0P0VI36`	Oryza sativa subsp. japonica	Nicotianamine aminotransferase 1	56.325%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card