LXL04_025566 | RubberDandelionOmics

Gene overview

LXL04_025566

Reference: OH-1004 Chr: Chr05 Coordinates: 113672787-113673483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_025566|LXL04_025566|OH1004|cDNA

ATGGCCTCCGATATGCCAGAAACTTCCAAACGGCAAGCATGGTTTTGTACCACCGGACTACCAAGCGACGCCATGGTTGATGTCGGCGACTTGACCTTCCATCTCCATAAGTTTCCTCTTATGGCTAAGAGCAAAAAGCTTAACGAGATGATGGCAGAACAAGAGACGAATGTCACAGTTAAAGCTACTAACCCGAGGGAATCTGAAGAAGATGAGCACGAAGAGATACAGGAAGAGAAAATAGCGGAGATGGCGGTTGA...

CDS

Download CDS FASTA

528 bp · LXL04_025566|LXL04_025566|OH1004|CDS

ATGGCCTCCGATATGCCAGAAACTTCCAAACGGCAAGCATGGTTTTGTACCACCGGACTACCAAGCGACGCCATGGTTGATGTCGGCGACTTGACCTTCCATCTCCATAAGTTTCCTCTTATGGCTAAGAGCAAAAAGCTTAACGAGATGATGGCAGAACAAGAGACGAATGTCACAGTTAAAGCTACTAACCCGAGGGAATCTGAAGAAGATGAGCACGAAGAGATACAGGAAGAGAAAATAGCGGAGATGGCGGTTGA...

Protein

Download Protein FASTA

175 aa · LXL04_025566|LXL04_025566|OH1004|PROTEIN

MASDMPETSKRQAWFCTTGLPSDAMVDVGDLTFHLHKFPLMAKSKKLNEMMAEQETNVTVKATNPRESEEDEHEEIQEEKIAEMAVDEHCHITLPDFPGGSETFETAAKFCYAVKIELSAFNVAAIVQATNTRDLNPEIIENCLLSYAKKHIPGVNRAGRRSSSSSVLPEIEVYD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025566`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025566

Location Chr05:113672787-113673483 (-)

Description Similar to At5g66560: BTB/POZ domain-containing protein At5g66560

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66560`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g03250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50840`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g64330`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Arabidopsis NPH3: A NPH1 photoreceptor-interacting protein essential for phototropism.1999 · DOI: 10.1126/science.286.5441.961 RPT2. A signal transducer of the phototropic response in Arabidopsis.2000 · DOI: 10.1105/tpc.12.2.225 RPT2 is a signal transducer involved in phototropic response and stomatal opening by association with phototropin 1 in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019901 PHYTOCHROME KINASE SUBSTRATE 1 is a phototropin 1 binding protein required for phototropism.2006 · DOI: 10.1073/pnas.0603799103 The Arabidopsis PHYTOCHROME KINASE SUBSTRATE2 protein is a phototropin signaling element that regulates leaf flattening and leaf positioning.2010 · DOI: 10.1104/pp.109.150441

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025566 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT3G50840

ath:AT5G03250

ath:AT5G66560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · LXL04_025566 · OH-1004

Nucleus0.414

Rank 2 · LXL04_025566 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_025566 · OH-1004

Mitochondrion0.066

Rank 4 · LXL04_025566 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_025566 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A73`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g66560	41.566%	Swiss-Prot	moderate database homology
`Q9S9Q9`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g30440	40.146%	Swiss-Prot	moderate database homology
`Q9LYW0`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g03250	39.130%	Swiss-Prot	moderate database homology
`Q8LPQ3`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g50840	43.363%	Swiss-Prot	moderate database homology
`Q9FMF5`	Arabidopsis thaliana	Root phototropism protein 3	30.657%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card