LXL04_025548 | RubberDandelionOmics

Gene overview

LXL04_025548

Reference: OH-1004 Chr: Chr05 Coordinates: 113269969-113271456 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_025548|LXL04_025548|OH1004|cDNA

ATGGGCAGATCACCATGTTGTGACAAAACCGGACTCAAGAAAGGGCCATGGACTCCAGAAGAAGACCTCAAACTCACACAATATATTCAAATCCATGGACCTGGCAATTGGCGAACCCTTCCAAAGAACTCTGGACTTGAACGATGTGGGAAAAGTTGTCGTCTTAGATGGACAAACTACTTGAGGCCTGATATCAAGAGAGGAAGATTCTCgtttgaagaagaagagagcATCATTCAACTACATAGTGTTCTTGGAAA...

CDS

Download CDS FASTA

1008 bp · LXL04_025548|LXL04_025548|OH1004|CDS

ATGGGCAGATCACCATGTTGTGACAAAACCGGACTCAAGAAAGGGCCATGGACTCCAGAAGAAGACCTCAAACTCACACAATATATTCAAATCCATGGACCTGGCAATTGGCGAACCCTTCCAAAGAACTCTGGACTTGAACGATGTGGGAAAAGTTGTCGTCTTAGATGGACAAACTACTTGAGGCCTGATATCAAGAGAGGAAGATTCTCGTTTGAAGAAGAAGAGAGCATCATTCAACTACATAGTGTTCTTGGAAA...

Protein

Download Protein FASTA

335 aa · LXL04_025548|LXL04_025548|OH1004|PROTEIN

MGRSPCCDKTGLKKGPWTPEEDLKLTQYIQIHGPGNWRTLPKNSGLERCGKSCRLRWTNYLRPDIKRGRFSFEEEESIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNTHIRKRLLKNGIDPVTHRPRIDLIDLSSILTSASFNLSNLLKIQTLVNPQVLRLATLLASSSSSNQENKELFLNNYINQNPNEPIPNVASNPSNLGCNQLWNQEHHMQVDNGQYYSGNLVNLNDQSRQEKLMPSCLNDHYNSIPLQNYSDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025548`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025548

Location Chr05:113269969-113271456 (+)

Description Similar to MYB102: Transcription factor MYB102

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312
`At4g28110`	Transcription factor involved in salt stress response.	AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874 Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137 AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624
`At3g01140`	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation.	Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.2008 · DOI: 10.1104/pp.108.126979 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826
`At5g15310`	Involved in the control of epidermal cell morphogenesis in petals.	Control of cell and petal morphogenesis by R2R3 MYB transcription factors.2007 · DOI: 10.1242/dev.02836 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025548 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010091 trichome branching Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080090 regulation of primary metabolic process Biological Process

KEGG gene cross-reference

ath:AT3G01140

ath:AT4G05100

ath:AT4G21440

ath:AT4G28110

ath:AT5G15310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.863

Rank 1 · LXL04_025548 · OH-1004

Cytoplasm0.280

Rank 2 · LXL04_025548 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_025548 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_025548 · OH-1004

Lysosome / Vacuole0.011

Rank 5 · LXL04_025548 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-76 aa

PF00249.38Myb_DNA-binding67-111 aa

PF13921.13Myb_DNA-bind_671-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025548	`PF00249.38`	Myb_DNA-binding	14	61	2.4e-35	121.1
LXL04_025548	`PF13921.13`	Myb_DNA-bind_6	17	76	7.8e-19	68.3
LXL04_025548	`PF00249.38`	Myb_DNA-binding	67	111	2.4e-35	121.1
LXL04_025548	`PF13921.13`	Myb_DNA-bind_6	71	114	7.8e-19	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDR8`	Arabidopsis thaliana	Transcription factor MYB102	49.189%	Swiss-Prot	moderate database homology
`Q9M0Y5`	Arabidopsis thaliana	Transcription factor MYB74	51.304%	Swiss-Prot	strong database homology
`Q9M0J5`	Arabidopsis thaliana	Transcription factor MYB41	50.442%	Swiss-Prot	strong database homology
`Q9LE63`	Arabidopsis thaliana	Transcription factor MYB106	58.201%	Swiss-Prot	moderate database homology
`Q9LXF1`	Arabidopsis thaliana	Transcription factor MYB16	57.513%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card