LXL04_025512 | RubberDandelionOmics

Gene overview

LXL04_025512

Reference: OH-1004 Chr: Chr05 Coordinates: 112774802-112775445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_025512|LXL04_025512|OH1004|cDNA

ATGGATTCCGCTCTGTTTCCACCTGCCTCACCTGTACCGCTTCCGGAAATTTCCCATGTCGGTTTATTGAGTCGGTGGCCTCTGTATTATTGCCGCCTTCCTTCACCTACCTCATGGTCACTTAATGCAATGCTTACTTCTCAATTTGGTGATGTGAAGAATGAGATTGTACTTTTTGGAGAGAATAAATCTGTGGAAGACTTTTTAGGAGATTACTTTGGGTTTCACCATCATCAGTTACCACTTGCAGGCGTTCTTCT...

CDS

Download CDS FASTA

486 bp · LXL04_025512|LXL04_025512|OH1004|CDS

ATGGATTCCGCTCTGTTTCCACCTGCCTCACCTGTACCGCTTCCGGAAATTTCCCATGTCGGTTTATTGAGTCGGTGGCCTCTGTATTATTGCCGCCTTCCTTCACCTACCTCATGGTCACTTAATGCAATGCTTACTTCTCAATTTGGTGATGTGAAGAATGAGATTGTACTTTTTGGAGAGAATAAATCTGTGGAAGACTTTTTAGGAGATTACTTTGGGTTTCACCATCATCAGTTACCACTTGCAGGCGTTCTTCT...

Protein

Download Protein FASTA

161 aa · LXL04_025512|LXL04_025512|OH1004|PROTEIN

MDSALFPPASPVPLPEISHVGLLSRWPLYYCRLPSPTSWSLNAMLTSQFGDVKNEIVLFGENKSVEDFLGDYFGFHHHQLPLAGVLLVLYPIILAISLTAALQKQTGLSCIGRQKEQADEAQEGGKRRNREKQITERKAVVVEMYQKQPTLHTDLRKLEGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025512`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025512

Location Chr05:112774802-112775445 (-)

Description Similar to PDR3: Pleiotropic drug resistance protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15233`	May be a general defense protein.	No verified direct reference in this release
`At4g15236`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0528900`	May be a general defense protein.	No verified direct reference in this release
`Os12g0512700`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025512 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G15233

ath:AT4G15236

dosa:Os02g0528900

dosa:Os12g0512700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.394

Rank 1 · LXL04_025512 · OH-1004

Cell membrane0.287

Rank 2 · LXL04_025512 · OH-1004

Cytoplasm0.210

Rank 3 · LXL04_025512 · OH-1004

Golgi apparatus0.167

Rank 4 · LXL04_025512 · OH-1004

Nucleus0.139

Rank 5 · LXL04_025512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC82`	Arabidopsis thaliana	ABC transporter G family member 42	53.521%	Swiss-Prot	weak database homology
`Q7PC81`	Arabidopsis thaliana	ABC transporter G family member 43	52.113%	Swiss-Prot	weak database homology
`Q8GU83`	Oryza sativa subsp. japonica	ABC transporter G family member 41	46.875%	Swiss-Prot	moderate database homology
`B9GDE5`	Oryza sativa subsp. japonica	ABC transporter G family member 50	46.753%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card