LXL04_025493 | RubberDandelionOmics

Gene overview

LXL04_025493

Reference: OH-1004 Chr: Chr05 Coordinates: 112508508-112510022 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_025493|LXL04_025493|OH1004|cDNA

atggcGGAAGTTGTGGGAGCGAAAGAGAGCGCGGTGGTGGATGGTGGTTCGACGATGTTTAGCGAGGTGGAGGTGAGAGAGATGTCGGGGTTCAAGCGTGGTGGCGATGATCACGTGGAAGTCACGTGTGGGTGCACTAGCTTCTGCTACGGTGACGCCGTCGGCACGCTTAGGGTGTTCGCTAGTGGTGATCTCGAAATCCGATGCGATTGTACCCCTGGCTGTCAAGAAGGTCTCGCTTTTATCGTTCTTTCTTTACA...

CDS

Download CDS FASTA

768 bp · LXL04_025493|LXL04_025493|OH1004|CDS

ATGGCGGAAGTTGTGGGAGCGAAAGAGAGCGCGGTGGTGGATGGTGGTTCGACGATGTTTAGCGAGGTGGAGGTGAGAGAGATGTCGGGGTTCAAGCGTGGTGGCGATGATCACGTGGAAGTCACGTGTGGGTGCACTAGCTTCTGCTACGGTGACGCCGTCGGCACGCTTAGGGTGTTCGCTAGTGGTGATCTCGAAATCCGATGCGATTGTACCCCTGGCTGTCAAGAAGGTCTCGCTTTTATCGTTCTTTCTTTACA...

Protein

Download Protein FASTA

255 aa · LXL04_025493|LXL04_025493|OH1004|PROTEIN

MAEVVGAKESAVVDGGSTMFSEVEVREMSGFKRGGDDHVEVTCGCTSFCYGDAVGTLRVFASGDLEIRCDCTPGCQEGLAFIVLSLHPFAYKLTPAAFEKHSGRETARKWKNNIWVIVDGEKVPLSKTALLKYYNKALSKTSSQTTSQRVCHRDEFLKCTQCSKLRRFHLRTKEECRAYHDAFININNWNCSDMPFHKITCDDEEERASRRVYRGCLTSSTCRGCTSCVCFGCGTCRFSDCGCQSCIDFTRNVKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025493`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025493

Location Chr05:112508508-112510022 (+)

Description Similar to ULT1: Protein ULTRAPETALA 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28190`	Putative transcription factor that acts as a key negative regulator of cell accumulation in shoot and floral meristems.	The ULTRAPETALA1 gene functions early in Arabidopsis development to restrict shoot apical meristem activity and acts through WUSCHEL to regulate floral meristem determinacy.2004 · DOI: 10.1534/genetics.104.028787 ULTRAPETALA1 encodes a SAND domain putative transcriptional regulator that controls shoot and floral meristem activity in Arabidopsis.2005 · DOI: 10.1242/dev.01642 REBELOTE, SQUINT, and ULTRAPETALA1 function redundantly in the temporal regulation of floral meristem termination in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.107.053306 EMBRYONIC FLOWER1 and ULTRAPETALA1 Act Antagonistically on Arabidopsis Development and Stress Response.2013 · DOI: 10.1104/pp.112.213223
`At2g20825`	Putative transcription factor that acts as a key negative regulator of cell accumulation in shoot and floral meristems.	ULTRAPETALA1 encodes a SAND domain putative transcriptional regulator that controls shoot and floral meristem activity in Arabidopsis.2005 · DOI: 10.1242/dev.01642

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0010080 regulation of floral meristem growth Biological Process

GO:0010081 regulation of inflorescence meristem growth Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G20825

ath:AT4G28190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.887

Rank 1 · LXL04_025493 · OH-1004

Cytoplasm0.203

Rank 2 · LXL04_025493 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_025493 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_025493 · OH-1004

Mitochondrion0.020

Rank 5 · LXL04_025493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23292.2SAND_ULT128-134 aa

PF23293.2zf_ULT1152-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025493	`PF23292.2`	SAND_ULT1	28	134	1.5e-38	131.9
LXL04_025493	`PF23293.2`	zf_ULT1	152	250	6.2e-42	143.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZA8`	Arabidopsis thaliana	Protein ULTRAPETALA 1	62.810%	Swiss-Prot	strong database homology
`Q8S8I2`	Arabidopsis thaliana	Protein ULTRAPETALA 2	56.432%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card