Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · LXL04_025486|LXL04_025486|OH1004|cDNA
ATGCAAGAAACAGGAAAGGCGGAAGAAGAGATTGAGAGATGTATGTTGTGGAAGAGAGCAAGACAAAGAAAAAAAGGAGGTTACGACCCAAATGTGCAAATTATAGTTGATAAAATTGATGAGCTACAAAAAGCTGAAAATTTTGGAGATGTGGTGACTGAAACAGATGATGTGCTAACTCGGGCGCTTGGTACTGAGGAACATCGTGGTGCTGTTCGTGGGATGGGGAAATATGTAACCCCACACCAGTATTTTTATTT...
618 bp · LXL04_025486|LXL04_025486|OH1004|CDS
ATGCAAGAAACAGGAAAGGCGGAAGAAGAGATTGAGAGATGTATGTTGTGGAAGAGAGCAAGACAAAGAAAAAAAGGAGGTTACGACCCAAATGTGCAAATTATAGTTGATAAAATTGATGAGCTACAAAAAGCTGAAAATTTTGGAGATGTGGTGACTGAAACAGATGATGTGCTAACTCGGGCGCTTGGTACTGAGGAACATCGTGGTGCTGTTCGTGGGATGGGGAAATATGTAACCCCACACCAGTATTTTTATTT...
Protein
Download Protein FASTA205 aa · LXL04_025486|LXL04_025486|OH1004|PROTEIN
MQETGKAEEEIERCMLWKRARQRKKGGYDPNVQIIVDKIDELQKAENFGDVVTETDDVLTRALGTEEHRGAVRGMGKYVTPHQYFYLPKTIKTYMDNEKKKTGQRFDALESDVKTLRDHVNSVSEGASCVNNVKDDFEDGSFEDSPVSCMCTPYFGENLDDHAQVNDVLVEMGTYFQMQGVFEDYENKTHKKLVKSITKGKSRNL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025486 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025486 |
|---|---|
| Location | Chr05:112454480-112455738 (+) |
| Description | Similar to FDS-2: Farnesyl diphosphate synthase 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0033384 geranyl diphosphate biosynthetic process Biological Process GO:0045337 farnesyl diphosphate biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0004161 dimethylallyltranstransferase activity Molecular Function GO:0004337 (2E,6E)-farnesyl diphosphate synthase activity Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.