LXL04_025475 | RubberDandelionOmics

Gene overview

LXL04_025475

Reference: OH-1004 Chr: Chr05 Coordinates: 112242812-112244607 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_025475|LXL04_025475|OH1004|cDNA

ATGTGGACGAACAAAGACCATACCAATTTCACACCAAGAGGGTTTCCATTTTCCACACCCCAATCGAGGACTAACCGGGCTTGTTCTTGGAACAAGTATTCTTCTCCGCCGTCTGAAATCACGCAACCGCTGCAGCCGGCGTCGGAAAGGAAATGGAAGCCGCCACCGTATGACAATAATGTTAATGTCTTTAATGCCACCAGCGATTCTCCCTATTTCAGAGCCAAACATGTTCAGGTGGTAGACAAGAACCCAAGCAA...

CDS

Download CDS FASTA

1077 bp · LXL04_025475|LXL04_025475|OH1004|CDS

ATGTGGACGAACAAAGACCATACCAATTTCACACCAAGAGGGTTTCCATTTTCCACACCCCAATCGAGGACTAACCGGGCTTGTTCTTGGAACAAGTATTCTTCTCCGCCGTCTGAAATCACGCAACCGCTGCAGCCGGCGTCGGAAAGGAAATGGAAGCCGCCACCGTATGACAATAATGTTAATGTCTTTAATGCCACCAGCGATTCTCCCTATTTCAGAGCCAAACATGTTCAGGTGGTAGACAAGAACCCAAGCAA...

Protein

Download Protein FASTA

358 aa · LXL04_025475|LXL04_025475|OH1004|PROTEIN

MWTNKDHTNFTPRGFPFSTPQSRTNRACSWNKYSSPPSEITQPLQPASERKWKPPPYDNNVNVFNATSDSPYFRAKHVQVVDKNPSKAVAMFWAAINSGDRVDSALKDMTTTMKQLDRSDEAIEAIKSFRHMCPLGEQESLDNIMLELYKRSGRIEEQRQLLELRLKQIENESIQKMNRTSIARYQGKKIEITMGQEYSRLLGNLAWTYLQQDKYKQAEEIYRKALSLEPDKNKQCNLAICLMYTNQMTEAKFLLNSVRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025475`
TK1151 ID	TkA06G057370
OH-1004 ID	LXL04_025475
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025475

Location Chr05:112242812-112244607 (-)

Description Similar to MS5: Protein POLLENLESS 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20900`	Essential for male fertility, especially for microspore and pollen grain production.	Meiotic progression in Arabidopsis is governed by complex regulatory interactions between SMG7, TDM1, and the meiosis I-specific cyclin TAM.2010 · DOI: 10.1105/tpc.110.078378
`At5g44330`	Probably involved in the regulation of cell division.	No verified direct reference in this release
`At3g51280`	Probably involved in the regulation of cell division.	No verified direct reference in this release
`At5g48850`	Involved in the utilization of stored sulfate under sulfur- deficient conditions.	A sulphur deficiency-induced gene, sdi1, involved in the utilization of stored sulphate pools under sulphur-limiting conditions has potential as a diagnostic indicator of sulphur nutritional status.2009 · DOI: 10.1111/j.1467-7652.2008.00391.x
`At1g04770`	Involved in the utilization of stored sulfate under sulfur-deficient conditions.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025475 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006792 regulation of sulfur utilization Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010438 cellular response to sulfur starvation Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0017053 transcription repressor complex Cellular Component

KEGG gene cross-reference

ath:AT1G04770

ath:AT3G51280

ath:AT4G20900

ath:AT5G44330

ath:AT5G48850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455

Rank 1 · LXL04_025475 · OH-1004

Nucleus0.348

Rank 2 · LXL04_025475 · OH-1004

Plastid0.131

Rank 3 · LXL04_025475 · OH-1004

Cell membrane0.112

Rank 4 · LXL04_025475 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_025475 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13424.13TPR_12198-227 aa

PF00515.35TPR_1200-231 aa

PF13181.13TPR_8200-231 aa

PF07719.24TPR_2201-231 aa

PF14559.13TPR_19210-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025475	`PF13424.13`	TPR_12	198	227	1.5e-06	29.0
LXL04_025475	`PF00515.35`	TPR_1	200	231	8.9e-09	35.5
LXL04_025475	`PF13181.13`	TPR_8	200	231	2e-08	34.5
LXL04_025475	`PF07719.24`	TPR_2	201	231	3.7e-08	33.6
LXL04_025475	`PF14559.13`	TPR_19	210	264	1.2e-08	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUC3`	Arabidopsis thaliana	Protein POLLENLESS 3	45.533%	Swiss-Prot	moderate database homology
`Q9FKV5`	Arabidopsis thaliana	Protein POLLENLESS 3-LIKE 1	50.826%	Swiss-Prot	moderate database homology
`Q9SD20`	Arabidopsis thaliana	Protein POLLENLESS 3-LIKE 2	51.556%	Swiss-Prot	moderate database homology
`Q8GXU5`	Arabidopsis thaliana	Protein SULFUR DEFICIENCY-INDUCED 1	53.398%	Swiss-Prot	moderate database homology
`Q8L730`	Arabidopsis thaliana	Protein SULFUR DEFICIENCY-INDUCED 2	48.276%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card