LXL04_025471 | RubberDandelionOmics

Gene overview

LXL04_025471

Reference: OH-1004 Chr: Chr05 Coordinates: 112196348-112196734 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_025471|LXL04_025471|OH1004|cDNA

ATGTTGGGCAAGAAAATAGGATTCCTCAAGCGACTGGGAAGCAGGATTAAAGTAAGGGCCCACACAAGTCATGATTGTGAGCCATTTAGTTATGAGTGTTTGTCAAGCAGTGATGAATCATGCGCGAGTACCCCAAGAGGATGTATTGCATTATATGTTGGAGAAGAGAGACGAAGGTTTGTGGTTCACACTTCCCATCTTTCTCACCCGCTCTTCCAGATGTTATTAGAGAAGACGGCGGAAGAATTTGGATTCGTTCA...

CDS

Download CDS FASTA

387 bp · LXL04_025471|LXL04_025471|OH1004|CDS

ATGTTGGGCAAGAAAATAGGATTCCTCAAGCGACTGGGAAGCAGGATTAAAGTAAGGGCCCACACAAGTCATGATTGTGAGCCATTTAGTTATGAGTGTTTGTCAAGCAGTGATGAATCATGCGCGAGTACCCCAAGAGGATGTATTGCATTATATGTTGGAGAAGAGAGACGAAGGTTTGTGGTTCACACTTCCCATCTTTCTCACCCGCTCTTCCAGATGTTATTAGAGAAGACGGCGGAAGAATTTGGATTCGTTCA...

Protein

Download Protein FASTA

128 aa · LXL04_025471|LXL04_025471|OH1004|PROTEIN

MLGKKIGFLKRLGSRIKVRAHTSHDCEPFSYECLSSSDESCASTPRGCIALYVGEERRRFVVHTSHLSHPLFQMLLEKTAEEFGFVQKDRLVIPCSIDVFREVVRAVKCNNGKFDLRYLVEEIDYNAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025471`
TK1151 ID	TkA06G057600
OH-1004 ID	LXL04_025471
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025471

Location Chr05:112196348-112196734 (+)

Description Similar to SAUR41: Auxin-responsive protein SAUR41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16510`	Plays a role in the regulation of cell expansion, root meristem patterning and auxin transport.	Tissue-specific expression of SMALL AUXIN UP RNA41 differentially regulates cell expansion and root meristem patterning in Arabidopsis.2013 · DOI: 10.1093/pcp/pct028
`At1g79130`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At3g12830`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At5g18010`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	The SAUR19 subfamily of SMALL AUXIN UP RNA genes promote cell expansion.2012 · DOI: 10.1111/j.1365-313x.2012.04946.x SAUR Inhibition of PP2C-D Phosphatases Activates Plasma Membrane H+-ATPases to Promote Cell Expansion in Arabidopsis.2014 · DOI: 10.1105/tpc.114.126037 Constitutive Expression of Arabidopsis SMALL AUXIN UP RNA19 (SAUR19) in Tomato Confers Auxin-Independent Hypocotyl Elongation.2017 · DOI: 10.1104/pp.16.01514

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025471 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0060918 auxin transport Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16510

ath:AT1G79130

ath:AT3G12830

ath:AT5G18010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.548

Rank 1 · LXL04_025471 · OH-1004

Nucleus0.377

Rank 2 · LXL04_025471 · OH-1004

Cell membrane0.214

Rank 3 · LXL04_025471 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_025471 · OH-1004

Plastid0.030

Rank 5 · LXL04_025471 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible25-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025471	`PF02519.21`	Auxin_inducible	25	110	2.2e-23	83.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA49`	Arabidopsis thaliana	Auxin-responsive protein SAUR41	40.964%	Swiss-Prot	moderate database homology
`O64538`	Arabidopsis thaliana	Auxin-responsive protein SAUR40	42.029%	Swiss-Prot	moderate database homology
`Q9LTV3`	Arabidopsis thaliana	Auxin-responsive protein SAUR72	39.189%	Swiss-Prot	moderate database homology
`Q9FJG1`	Arabidopsis thaliana	Auxin-responsive protein SAUR19	44.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card