LXL04_025422 | RubberDandelionOmics

Gene overview

LXL04_025422

Reference: OH-1004 Chr: Chr05 Coordinates: 111402641-111404594 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · LXL04_025422|LXL04_025422|OH1004|cDNA

ATGGGCATCAGCGGGAAGGGATTTTCAGTGAAGGTGAGTGATAATGTAGTGGTGGTTGCAGAACAAGCATGTAAGGATGAGTGGTTACCCTTTACGAATCTAGACTTGCTTGTACCACCTTTTGACGTCGGCTCTTTCTTCTGCTACAAAAAACCCTCCCATGGAAGTTTCTCCGCCATGCTAAAAACACTCAAAGCTTCCTTATCAAAAGCTCTAGCACTCTACCACCCCCTCGCCGGCGATATCGTATGGAATGCAGC...

CDS

Download CDS FASTA

1383 bp · LXL04_025422|LXL04_025422|OH1004|CDS

ATGGGCATCAGCGGGAAGGGATTTTCAGTGAAGGTGAGTGATAATGTAGTGGTGGTTGCAGAACAAGCATGTAAGGATGAGTGGTTACCCTTTACGAATCTAGACTTGCTTGTACCACCTTTTGACGTCGGCTCTTTCTTCTGCTACAAAAAACCCTCCCATGGAAGTTTCTCCGCCATGCTAAAAACACTCAAAGCTTCCTTATCAAAAGCTCTAGCACTCTACCACCCCCTCGCCGGCGATATCGTATGGAATGCAGC...

Protein

Download Protein FASTA

460 aa · LXL04_025422|LXL04_025422|OH1004|PROTEIN

MGISGKGFSVKVSDNVVVVAEQACKDEWLPFTNLDLLVPPFDVGSFFCYKKPSHGSFSAMLKTLKASLSKALALYHPLAGDIVWNAAAGENQILCNNQGVDFISAVADVELRELNFYNPDESIEGKLMPKKTRGVMAVQVTELRCGGMAVGCQFDHRIVDGYSANMFISSWADISRTGTPSMFPSHGRSYLNPRCPIVSSTSIDNVFAPFVPPSETENGRNDDDGENILVNRIYYIKGEHLKRLQLLASENGCRRSKLEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025422`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025422

Location Chr05:111402641-111404594 (+)

Description Similar to HCBT1: Anthranilate N-benzoyltransferase protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41040`	Involved in the synthesis of aromatics of the suberin polymer.	Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907 A hydroxycinnamoyltransferase responsible for synthesizing suberin aromatics in Arabidopsis.2009 · DOI: 10.1073/pnas.0905555106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025422 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0034318 alcohol O-acyltransferase activity Molecular Function

GO:0047672 anthranilate N-benzoyltransferase activity Molecular Function

KEGG gene cross-reference

ag:ABG75942

ag:CAB06427

ath:AT5G41040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_025422 · OH-1004

Nucleus0.317

Rank 2 · LXL04_025422 · OH-1004

Cell membrane0.103

Rank 3 · LXL04_025422 · OH-1004

Endoplasmic reticulum0.102

Rank 4 · LXL04_025422 · OH-1004

Plastid0.052

Rank 5 · LXL04_025422 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase9-448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025422	`PF02458.21`	Transferase	9	448	1.2e-85	288.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CD1`	Arabidopsis thaliana	Omega-hydroxypalmitate O-feruloyl transferase	25.773%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card