LXL04_025388 | RubberDandelionOmics

Gene overview

LXL04_025388

Reference: OH-1004 Chr: Chr05 Coordinates: 110948061-110948950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · LXL04_025388|LXL04_025388|OH1004|cDNA

ATGGGTTCAGATTCATTCAGTGGTGATGAAACCGCGCCTTTCTTTGGATTTCTCGGCGCCGCTGCTGCCCTCGTCTTCTCCTGTATGGGAGCTGCGTATGGGACAGCGAAGAGTGGTGTTGGAGTGGCATCGATGGGAGTGATGAGGCCTGAGCTGGTGATGAAATCCATCGTTCCAGTGGTTATGGCTGGTGTGCTTGGTATTTACGGTTTGATTATTGCCGTCATCATCAGTACCGGAATCAACCCTAAGGCCAAGTC...

CDS

Download CDS FASTA

501 bp · LXL04_025388|LXL04_025388|OH1004|CDS

ATGGGTTCAGATTCATTCAGTGGTGATGAAACCGCGCCTTTCTTTGGATTTCTCGGCGCCGCTGCTGCCCTCGTCTTCTCCTGTATGGGAGCTGCGTATGGGACAGCGAAGAGTGGTGTTGGAGTGGCATCGATGGGAGTGATGAGGCCTGAGCTGGTGATGAAATCCATCGTTCCAGTGGTTATGGCTGGTGTGCTTGGTATTTACGGTTTGATTATTGCCGTCATCATCAGTACCGGAATCAACCCTAAGGCCAAGTC...

Protein

Download Protein FASTA

166 aa · LXL04_025388|LXL04_025388|OH1004|PROTEIN

MGSDSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025388`
TK1151 ID	TkA06G062120
OH-1004 ID	LXL04_025388
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.507 / OH-1004 79.518 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025388

Location Chr05:110948061-110948950 (+)

Description Similar to V-type proton ATPase 16 kDa proteolipid subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75630`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025388 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0033179 proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function

KEGG gene cross-reference

ath:AT1G75630

ghi:107903720

ghi:107909439

ghi:107920550

ghi:107936576

ghi:107949088

vra:106780537

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.312

Rank 1 · LXL04_025388 · OH-1004

Cytoplasm0.280

Rank 2 · LXL04_025388 · OH-1004

Cell membrane0.245

Rank 3 · LXL04_025388 · OH-1004

Endoplasmic reticulum0.127

Rank 4 · LXL04_025388 · OH-1004

Golgi apparatus0.107

Rank 5 · LXL04_025388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00137.27ATP-synt_C18-77 aa

PF00137.27ATP-synt_C98-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025388	`PF00137.27`	ATP-synt_C	18	77	8.8e-34	116.3
LXL04_025388	`PF00137.27`	ATP-synt_C	98	156	8.8e-34	116.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59229`	Arabidopsis thaliana	V-type proton ATPase subunit c4	97.590%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card