LXL04_025348 | RubberDandelionOmics

Gene overview

LXL04_025348

Reference: OH-1004 Chr: Chr05 Coordinates: 110230313-110230934 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · LXL04_025348|LXL04_025348|OH1004|cDNA

ATGCCATATATAAACATGCCCATTATTGAGAGTGGTCAAAGTGCGTGTGTAATTCAAGCTGTTCTTGTCGACGGAAGAGTAGAAACTGGGAGATTAGTGAACAATCAAATTGAATGGAGAGGAGATTCAGGGCTACAAGATGGAAAAGAAGAAGACCTCGATCTATCAAAAGGGTTGTACGATGCCGGAGACCTCATAAAATTTGGTTTTCCGATGGCGTTCAACAGAAAAGAGGTCGGCGATCCACGTCAACATAAATG...

CDS

Download CDS FASTA

525 bp · LXL04_025348|LXL04_025348|OH1004|CDS

ATGCCATATATAAACATGCCCATTATTGAGAGTGGTCAAAGTGCGTGTGTAATTCAAGCTGTTCTTGTCGACGGAAGAGTAGAAACTGGGAGATTAGTGAACAATCAAATTGAATGGAGAGGAGATTCAGGGCTACAAGATGGAAAAGAAGAAGACCTCGATCTATCAAAAGGGTTGTACGATGCCGGAGACCTCATAAAATTTGGTTTTCCGATGGCGTTCAACAGAAAAGAGGTCGGCGATCCACGTCAACATAAATG...

Protein

Download Protein FASTA

174 aa · LXL04_025348|LXL04_025348|OH1004|PROTEIN

MPYINMPIIESGQSACVIQAVLVDGRVETGRLVNNQIEWRGDSGLQDGKEEDLDLSKGLYDAGDLIKFGFPMAFNRKEVGDPRQHKCWERPETSTEKRPAIQVNMSHPGSDVAAETATAMAGASLVFKNHNARYSKSLLEHSWIGTRDYSAQLVVPKALEFVNRFEGGLDGIKG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025348`
TK1151 ID	TkA06G065040
OH-1004 ID	LXL04_025348
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 97.126 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025348

Location Chr05:110230313-110230934 (-)

Description Similar to Os06g0715300: Endoglucanase 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75680`	Endoglucanase 10.	No verified direct reference in this release
`At1g19940`	Endoglucanase 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0715300`	Endoglucanase 18.	No verified direct reference in this release
`Os09g0533900`	Endoglucanase 24.	No verified direct reference in this release
`Os08g0425300`	Endoglucanase 21.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025348 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G19940

ath:AT1G75680

dosa:Os06g0715300

dosa:Os09g0533900

osa:107276216

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.593

Rank 1 · LXL04_025348 · OH-1004

Cytoplasm0.164

Rank 2 · LXL04_025348 · OH-1004

Lysosome / Vacuole0.094

Rank 3 · LXL04_025348 · OH-1004

Nucleus0.068

Rank 4 · LXL04_025348 · OH-1004

Endoplasmic reticulum0.065

Rank 5 · LXL04_025348 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_930-74 aa

PF00759.26Glyco_hydro_978-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025348	`PF00759.26`	Glyco_hydro_9	30	74	1.9e-32	113.8
LXL04_025348	`PF00759.26`	Glyco_hydro_9	78	142	1.9e-32	113.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LCP6`	Arabidopsis thaliana	Endoglucanase 10	41.711%	Swiss-Prot	moderate database homology
`Q9FXI9`	Arabidopsis thaliana	Endoglucanase 2	44.099%	Swiss-Prot	moderate database homology
`Q5Z9P8`	Oryza sativa subsp. japonica	Endoglucanase 18	46.875%	Swiss-Prot	moderate database homology
`Q69SG5`	Oryza sativa subsp. japonica	Endoglucanase 24	46.584%	Swiss-Prot	moderate database homology
`Q84Q51`	Oryza sativa subsp. japonica	Endoglucanase 21	34.426%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card