LXL04_025331 | RubberDandelionOmics

Gene overview

LXL04_025331

Reference: OH-1004 Chr: Chr05 Coordinates: 109904395-109910023 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

936 bp · LXL04_025331|LXL04_025331|OH1004|cDNA

ATGGACGTTGACGGCGCTAGGAAATCAGGAACCGTCAAGTGGTTCAACGACACCAAGGGATTTGGTTTCATCACTCCTGAAGATGGCGGTGAGGAGCTTTTTGTTCACCAATCGTCCATCAGAACGGAGGGATTCCGCAGCCTTGGTGACGGTGAGACCGTTGAGTACGTGATTGAGAACGGATCTGATGGCCGTACTAAAGCAGCTGATGTTACCGGCCCCAATGAAGGTCCCGTCCAGGGGAGTACccgtggtggtgg...

CDS

Download CDS FASTA

936 bp · LXL04_025331|LXL04_025331|OH1004|CDS

ATGGACGTTGACGGCGCTAGGAAATCAGGAACCGTCAAGTGGTTCAACGACACCAAGGGATTTGGTTTCATCACTCCTGAAGATGGCGGTGAGGAGCTTTTTGTTCACCAATCGTCCATCAGAACGGAGGGATTCCGCAGCCTTGGTGACGGTGAGACCGTTGAGTACGTGATTGAGAACGGATCTGATGGCCGTACTAAAGCAGCTGATGTTACCGGCCCCAATGAAGGTCCCGTCCAGGGGAGTACCCGTGGTGGTGG...

Protein

Download Protein FASTA

311 aa · LXL04_025331|LXL04_025331|OH1004|PROTEIN

MDVDGARKSGTVKWFNDTKGFGFITPEDGGEELFVHQSSIRTEGFRSLGDGETVEYVIENGSDGRTKAADVTGPNEGPVQGSTRGGGGGGGGRGGGGGDRYGGGGGDRYGGGGGGYNGGSRGGRGGGGYGGGGGGYGGGGGYGGGGGGGNACFKCGESGHMARECTQNGGGGGGGYGGRGGGGYGGGGGRGGGGGGGGGGCYNCGEDGHFARECPTSNNRVVCYSTDSDSDSDHGPRTTDRVRHQTRLSNASDHGPSPTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025331`
TK1151 ID	TkA06G063640
OH-1004 ID	LXL04_025331
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.200
Protein coverage (%)	TK1151 100.000 / OH-1004 70.740 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025331

Location Chr05:109904395-109910023 (-)

Description Similar to GRP-2: Glycine-rich protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17870`	Chaperone that binds to RNA, single- (ssDNA) and double-stranded (dsDNA) DNA, and unwinds nucleic acid duplex.	Cold shock domain protein 3 regulates freezing tolerance in Arabidopsis thaliana.2009 · DOI: 10.1074/jbc.m109.025791

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025331 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0140691 RNA folding chaperone Molecular Function

KEGG gene cross-reference

ath:AT2G17870

ell:WFL_03370

elw:ECW_m0678

nsy:104218376

sfl:SF0657

sfx:S0680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.626

Rank 1 · LXL04_025331 · OH-1004

Nucleus0.513

Rank 2 · LXL04_025331 · OH-1004

Extracellular0.136

Rank 3 · LXL04_025331 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_025331 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_025331 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00313.29CSD9-73 aa

PF00098.29zf-CCHC151-167 aa

PF00098.29zf-CCHC200-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025331	`PF00313.29`	CSD	9	73	3.4e-25	88.4
LXL04_025331	`PF00098.29`	zf-CCHC	151	167	4.8e-16	58.7
LXL04_025331	`PF00098.29`	zf-CCHC	200	215	4.8e-16	58.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C69`	Arabidopsis thaliana	Cold shock domain-containing protein 3	40.376%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card