LXL04_025326 | RubberDandelionOmics

Gene overview

LXL04_025326

Reference: OH-1004 Chr: Chr05 Coordinates: 109878411-109880064 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · LXL04_025326|LXL04_025326|OH1004|cDNA

ATGGCATCGCAAAGCCTGAAAAACCCTAAAAGTCTTTATCCAGAAGTAATTCAATCAAACCCAGATTCAGCCCCAACATTTTCTtattcatcatcatcatcctaTTCTCCTTCTGCCCCGTCTCTATACCCAACTATTGATATGAAAGACCTCAACGAAGATCTCTTTGTTGACACTCATCAATCTTATGATCCTCAACTACTATCGCCTTTCGAATCATCTGAGGAAGTTGTTATAAAAATCCCAGGTTCAATCATTCA...

CDS

Download CDS FASTA

1347 bp · LXL04_025326|LXL04_025326|OH1004|CDS

ATGGCATCGCAAAGCCTGAAAAACCCTAAAAGTCTTTATCCAGAAGTAATTCAATCAAACCCAGATTCAGCCCCAACATTTTCTTATTCATCATCATCATCCTATTCTCCTTCTGCCCCGTCTCTATACCCAACTATTGATATGAAAGACCTCAACGAAGATCTCTTTGTTGACACTCATCAATCTTATGATCCTCAACTACTATCGCCTTTCGAATCATCTGAGGAAGTTGTTATAAAAATCCCAGGTTCAATCATTCA...

Protein

Download Protein FASTA

448 aa · LXL04_025326|LXL04_025326|OH1004|PROTEIN

MASQSLKNPKSLYPEVIQSNPDSAPTFSYSSSSSYSPSAPSLYPTIDMKDLNEDLFVDTHQSYDPQLLSPFESSEEVVIKIPGSIIHLIDELQSIELASGELEIIRLRQGTTVVAVLARVGDVIQWPLAKDEAAVKLDGSHYFFTLRVPSDTKSGNDSDFESESLLNYGLTVTGKGLEKVLEEFDRVLEEYSAFSVKEVKRSVSAAVAVDNGGSAEAKASAYWTTLAPNVEDYSGSVARMIATGSGQLIKGILWCGDVTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025326`
TK1151 ID	TkA05G071390
OH-1004 ID	LXL04_025326
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.200
Protein coverage (%)	TK1151 99.034 / OH-1004 96.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025326

Location Chr05:109878411-109880064 (-)

Description Similar to ERD7: Protein EARLY-RESPONSIVE TO DEHYDRATION 7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17840`	Protein EARLY-RESPONSIVE TO DEHYDRATION 7, chloroplastic.	No verified direct reference in this release
`At3g51250`	Senescence/dehydration-associated protein At3g51250.	No verified direct reference in this release
`At4g35985`	Senescence/dehydration-associated protein At4g35985, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025326 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G17840

ath:AT3G51250

ath:AT4G35985

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.381

Rank 1 · LXL04_025326 · OH-1004

Cell membrane0.275

Rank 2 · LXL04_025326 · OH-1004

Nucleus0.192

Rank 3 · LXL04_025326 · OH-1004

Golgi apparatus0.108

Rank 4 · LXL04_025326 · OH-1004

Plastid0.101

Rank 5 · LXL04_025326 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06911.19Senescence240-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025326	`PF06911.19`	Senescence	240	425	6.5e-50	170.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48832`	Arabidopsis thaliana	Protein EARLY-RESPONSIVE TO DEHYDRATION 7, chloroplastic	54.130%	Swiss-Prot	strong database homology
`Q9SD22`	Arabidopsis thaliana	Senescence/dehydration-associated protein At3g51250	51.670%	Swiss-Prot	strong database homology
`F4JNX2`	Arabidopsis thaliana	Senescence/dehydration-associated protein At4g35985, chloroplastic	52.466%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card