LXL04_025281 | RubberDandelionOmics

Gene overview

LXL04_025281

Reference: OH-1004 Chr: Chr05 Coordinates: 109105528-109107793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · LXL04_025281|LXL04_025281|OH1004|cDNA

ATGGGGATTTGCTGTTCATCGCATAATAAAGTTCCTGGGACCATTCTCGATCCCAGTTCAGGGTTTTCGCAGTCAGTCACCACAAACAATACCACAAGCTCATCATTATCGTCACGCGGTGGCAGCAACATCTCCCGGAGCAGCCAGTTTTGGTCGGCAAACAGCGGCGATGAATTTGGACCAGACGGCCAGATCTTACCTCACCCCAACCTTAAAATATACACCTTCTCTGAACTCAAAACCGCCACAAAAAACTTCAG...

CDS

Download CDS FASTA

1260 bp · LXL04_025281|LXL04_025281|OH1004|CDS

ATGGGGATTTGCTGTTCATCGCATAATAAAGTTCCTGGGACCATTCTCGATCCCAGTTCAGGGTTTTCGCAGTCAGTCACCACAAACAATACCACAAGCTCATCATTATCGTCACGCGGTGGCAGCAACATCTCCCGGAGCAGCCAGTTTTGGTCGGCAAACAGCGGCGATGAATTTGGACCAGACGGCCAGATCTTACCTCACCCCAACCTTAAAATATACACCTTCTCTGAACTCAAAACCGCCACAAAAAACTTCAG...

Protein

Download Protein FASTA

419 aa · LXL04_025281|LXL04_025281|OH1004|PROTEIN

MGICCSSHNKVPGTILDPSSGFSQSVTTNNTTSSSLSSRGGSNISRSSQFWSANSGDEFGPDGQILPHPNLKIYTFSELKTATKNFRNDTVLGEGGFGKVHKGFIEEKSISKHGTGSVIAVKKLNSESMQGLEEWQAEVNFLGRLSHPNLVKLLGYCYEGKELLLVYEFMQKGSLENHLFGRGSSVQSLPWDLRVKILIGAARGLAFLHSSDIKIIYRDFKASNILLDGSYNGKLSDFGLAKLASSSQSHVTTRVMGTYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025281`
TK1151 ID	TkA06G070150
OH-1004 ID	LXL04_025281
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025281

Location Chr05:109105528-109107793 (+)

Description Similar to PIX13: Probable serine/threonine-protein kinase PIX13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17220`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g35600`	Acts as a spatial inhibitor of signaling that modulates abscission zone cell adhesion and expansion.	No verified direct reference in this release
`At1g07570`	Possible bi-functional kinase.	Novel protein kinase of Arabidopsis thaliana (APK1) that phosphorylates tyrosine, serine and threonine.1992 · DOI: 10.1007/bf00046450
`At2g28930`	Possible bi-functional kinase.	Light-induced stomatal opening is affected by the guard cell protein kinase APK1b.2014 · DOI: 10.1371/journal.pone.0097161

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009838 abscission Biological Process

GO:0045087 innate immune response Biological Process

GO:0060862 negative regulation of floral organ abscission Biological Process

GO:1902458 positive regulation of stomatal opening Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07570

ath:AT2G17220

ath:AT2G28930

ath:AT4G35600

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.685

Rank 1 · LXL04_025281 · OH-1004

Cytoplasm0.245

Rank 2 · LXL04_025281 · OH-1004

Nucleus0.241

Rank 3 · LXL04_025281 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_025281 · OH-1004

Golgi apparatus0.027

Rank 5 · LXL04_025281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase88-363 aa

PF07714.24PK_Tyr_Ser-Thr89-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025281	`PF00069.32`	Pkinase	88	363	2.6e-45	155.6
LXL04_025281	`PF07714.24`	PK_Tyr_Ser-Thr	89	365	2.1e-46	159.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SII6`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PIX13	64.973%	Swiss-Prot	strong database homology
`P27450`	Arabidopsis thaliana	Probable serine/threonine-protein kinase CST	53.230%	Swiss-Prot	strong database homology
`Q06548`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL9	56.150%	Swiss-Prot	strong database homology
`P46573`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL10	60.635%	Swiss-Prot	strong database homology
`Q65XV8`	Oryza sativa subsp. japonica	Receptor-like cytoplasmic kinase 176	58.824%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card