LXL04_025248 | RubberDandelionOmics

Gene overview

LXL04_025248

Reference: OH-1004 Chr: Chr05 Coordinates: 108614004-108620686 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2361 bp · LXL04_025248|LXL04_025248|OH1004|cDNA

ATGGCGTCGGCCTCTTGTCTGATAATCTCTTCAACTATCCCATCGTCGTCTTCCTCAAAATGGGTTTCAATTCCCATGTCCTATTACCAAAATAACACTTGCTTTGAACGATTCCACCTCAGTAAAAGCTTCTCTAAATATACGATAAACCCTTCACGCCCAGCTACAAGAAACCCTAAAACCCTAATTGTTAGAGCTGCCGAATACAAATTCCCAGACCCAATACCAGAATTCGCCGAAGCTGAGACTGAGAAATTCAG...

CDS

Download CDS FASTA

2361 bp · LXL04_025248|LXL04_025248|OH1004|CDS

ATGGCGTCGGCCTCTTGTCTGATAATCTCTTCAACTATCCCATCGTCGTCTTCCTCAAAATGGGTTTCAATTCCCATGTCCTATTACCAAAATAACACTTGCTTTGAACGATTCCACCTCAGTAAAAGCTTCTCTAAATATACGATAAACCCTTCACGCCCAGCTACAAGAAACCCTAAAACCCTAATTGTTAGAGCTGCCGAATACAAATTCCCAGACCCAATACCAGAATTCGCCGAAGCTGAGACTGAGAAATTCAG...

Protein

Download Protein FASTA

786 aa · LXL04_025248|LXL04_025248|OH1004|PROTEIN

MASASCLIISSTIPSSSSSKWVSIPMSYYQNNTCFERFHLSKSFSKYTINPSRPATRNPKTLIVRAAEYKFPDPIPEFAEAETEKFRSHLIDKLSKKDVFEDSVDEVVEICTEIFGKFMNAEYGGPGTLMVDPFWEMADTINESELPGGPQAARAAVKWAQNHVDNDWKEWNVYDQPINYHNRGVQLGDQPTNHPPQRNPPPIAPFRSSPERALFLRYSAVDGIDELKAKKHLSEEDCGRNYFVMNSLFNACSTALFART...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025248

Location Chr05:108614004-108620686 (+)

Description Similar to PRIN2: Protein PLASTID REDOX INSENSITIVE 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10522`	Involved in redox-mediated retrograde signaling to synchronize the expression of photosynthetic genes from both the nuclear and plastidic genomes, especially in excess light conditions.	The plastid redox insensitive 2 mutant of Arabidopsis is impaired in PEP activity and high light-dependent plastid redox signalling to the nucleus.2012 · DOI: 10.1111/j.1365-313x.2011.04865.x Plastid encoded RNA polymerase activity and expression of photosynthesis genes required for embryo and seed development in Arabidopsis.2014 · DOI: 10.3389/fpls.2014.00385

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0382400`	Required for the activity of the plastid-encoded RNA polymerase (PEP) and full expression of genes transcribed by PEP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009642 response to light intensity Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0000427 plastid-encoded plastid RNA polymerase complex Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0042646 plastid nucleoid Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G10522

dosa:Os09g0382400

zma:100278908

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.955

Rank 1 · LXL04_025248 · OH-1004

Mitochondrion0.049

Rank 2 · LXL04_025248 · OH-1004

Nucleus0.038

Rank 3 · LXL04_025248 · OH-1004

Cytoplasm0.028

Rank 4 · LXL04_025248 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_025248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13456.13RVT_3487-607 aa

PF00075.31RNase_H487-593 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025248	`PF13456.13`	RVT_3	487	607	2.9e-24	86.0
LXL04_025248	`PF00075.31`	RNase_H	487	593	1.7e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIK0`	Arabidopsis thaliana	Protein PLASTID REDOX INSENSITIVE 2, chloroplastic	73.276%	Swiss-Prot	weak database homology
`Q6H612`	Oryza sativa subsp. japonica	Protein PLASTID REDOX INSENSITIVE 2, chloroplastic	48.819%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card