LXL04_025243 | RubberDandelionOmics

Gene overview

LXL04_025243

Reference: OH-1004 Chr: Chr05 Coordinates: 108535917-108536540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_025243|LXL04_025243|OH1004|cDNA

ATGGGAGAAGTGTCCAATTTTCTTTCCTCAAGATTGGTGAGAGAGGATGCAGATTCTTCATGTCCATCAATATCGGTAGACAAAAAGATTAGATTATTCGGGTTTGAGCTTGATCCTCTTAAAAATGGCTCGATGCTAAGCAAACAAGAGTCACTTTCCACCACAATCTCCTCCGCGAAAGAGAAATTCACCATGGAGAATTCcaaagaaatgaagaagttcgAGTGCCAATATTGTTTCAAAGGGTTCATAACCTCACA...

CDS

Download CDS FASTA

624 bp · LXL04_025243|LXL04_025243|OH1004|CDS

ATGGGAGAAGTGTCCAATTTTCTTTCCTCAAGATTGGTGAGAGAGGATGCAGATTCTTCATGTCCATCAATATCGGTAGACAAAAAGATTAGATTATTCGGGTTTGAGCTTGATCCTCTTAAAAATGGCTCGATGCTAAGCAAACAAGAGTCACTTTCCACCACAATCTCCTCCGCGAAAGAGAAATTCACCATGGAGAATTCCAAAGAAATGAAGAAGTTCGAGTGCCAATATTGTTTCAAAGGGTTCATAACCTCACA...

Protein

Download Protein FASTA

207 aa · LXL04_025243|LXL04_025243|OH1004|PROTEIN

MGEVSNFLSSRLVREDADSSCPSISVDKKIRLFGFELDPLKNGSMLSKQESLSTTISSAKEKFTMENSKEMKKFECQYCFKGFITSQALGGHQNAHKRERMKKKKLLLQARKASISKYLQPHDQIIDNHGININFHGRNACAFTKPNISFGLYDDDILSFSDTNNFGYKHARHSRRMRSSLYVDDSKQSCKGLDLQLALGSYAGATM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025243`
TK1151 ID	TkA06G072210
OH-1004 ID	LXL04_025243
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 78.744 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025243

Location Chr05:108535917-108536540 (+)

Description Similar to ZFP5: Zinc finger protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10480`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin (GA).	Zinc finger protein5 is required for the control of trichome initiation by acting upstream of zinc finger protein8 in Arabidopsis.2011 · DOI: 10.1104/pp.111.180281 ZFP5 encodes a functionally equivalent GIS protein to control trichome initiation.2012 · DOI: 10.4161/psb.7.1.18404 A zinc finger protein gene ZFP5 integrates phytohormone signaling to control root hair development in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05094.x
`At5g06650`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Integration of cytokinin and gibberellin signalling by Arabidopsis transcription factors GIS, ZFP8 and GIS2 in the regulation of epidermal cell fate.2007 · DOI: 10.1242/dev.005017
`At2g41940`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Integration of cytokinin and gibberellin signalling by Arabidopsis transcription factors GIS, ZFP8 and GIS2 in the regulation of epidermal cell fate.2007 · DOI: 10.1242/dev.005017
`At1g68360`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	GLABROUS INFLORESCENCE STEMS3 (GIS3) regulates trichome initiation and development in Arabidopsis.2015 · DOI: 10.1111/nph.13218
`At3g58070`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin (GA).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

KEGG gene cross-reference

ath:AT1G10480

ath:AT1G68360

ath:AT2G41940

ath:AT3G58070

ath:AT5G06650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · LXL04_025243 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_025243 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_025243 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_025243 · OH-1004

Plastid0.010

Rank 5 · LXL04_025243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39264`	Arabidopsis thaliana	Zinc finger protein 5	43.056%	Swiss-Prot	moderate database homology
`Q9FG05`	Arabidopsis thaliana	Zinc finger protein GIS2	42.708%	Swiss-Prot	weak database homology
`P93751`	Arabidopsis thaliana	Zinc finger protein 8	56.250%	Swiss-Prot	weak database homology
`Q9C9H1`	Arabidopsis thaliana	Zinc finger protein GIS3	34.234%	Swiss-Prot	weak database homology
`Q84WI0`	Arabidopsis thaliana	Zinc finger protein GIS	38.889%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card