LXL04_025236 | RubberDandelionOmics

Gene overview

LXL04_025236

Reference: OH-1004 Chr: Chr05 Coordinates: 108360986-108364257 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1341 bp · LXL04_025236|LXL04_025236|OH1004|cDNA

ATGGGTCGTTTTCGATTTTGCAGTCGATCGTTAAACGACGCCATTATCGCTCTGTTATTGTTATCTTTCCCTATGATGTGCTTTGGGATTCGTTATTTTTCTTCCAACGGAGATATTGAGGCTCATTCGGGATCTGAGGTTTTGTTTGGCTATACTGAAGCGCCGGAATACCGAAACGGCGTAGGCTGCTCACGCGATAGCATTCATGTCGCAATGACGATCGACTTGGAGTACTTACGTGGCTCGATAGCCGCCGTACA...

CDS

Download CDS FASTA

1341 bp · LXL04_025236|LXL04_025236|OH1004|CDS

ATGGGTCGTTTTCGATTTTGCAGTCGATCGTTAAACGACGCCATTATCGCTCTGTTATTGTTATCTTTCCCTATGATGTGCTTTGGGATTCGTTATTTTTCTTCCAACGGAGATATTGAGGCTCATTCGGGATCTGAGGTTTTGTTTGGCTATACTGAAGCGCCGGAATACCGAAACGGCGTAGGCTGCTCACGCGATAGCATTCATGTCGCAATGACGATCGACTTGGAGTACTTACGTGGCTCGATAGCCGCCGTACA...

Protein

Download Protein FASTA

446 aa · LXL04_025236|LXL04_025236|OH1004|PROTEIN

MGRFRFCSRSLNDAIIALLLLSFPMMCFGIRYFSSNGDIEAHSGSEVLFGYTEAPEYRNGVGCSRDSIHVAMTIDLEYLRGSIAAVHSVLRHASCPENVHFHFIAAEFDPASPRDLTRLVRSTFPSLNFKVYIFREDTVINLISSSIRIALENPLNYARNYLGDILDPYVDRVIYLDSDVVIVDDIQKLWNITLQNNRVIGAPEYCHTNFTKYFTDSFWSDPMMSRVFGSRKPCYFNTGVMVMDMEKWRKGNYRKRIENW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025236`
TK1151 ID	TkA06G072780
OH-1004 ID	LXL04_025236
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.861 / OH-1004 82.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025236

Location Chr05:108360986-108364257 (+)

Description Similar to GATL9: Probable galacturonosyltransferase-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70090`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g24170`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g28340`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025236 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24170

ath:AT1G70090

ath:AT3G28340

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.781

Rank 1 · LXL04_025236 · OH-1004

Endoplasmic reticulum0.096

Rank 2 · LXL04_025236 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_025236 · OH-1004

Cell membrane0.069

Rank 4 · LXL04_025236 · OH-1004

Extracellular0.055

Rank 5 · LXL04_025236 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501.27Glyco_transf_869-329 aa

PF18404.8Glyco_transf_24158-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025236	`PF01501.27`	Glyco_transf_8	69	329	4.5e-57	194.2
LXL04_025236	`PF18404.8`	Glyco_transf_24	158	253	1e-05	25.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04536`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 9	67.526%	Swiss-Prot	strong database homology
`O48684`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 8	74.383%	Swiss-Prot	moderate database homology
`Q9LHD2`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 10	64.669%	Swiss-Prot	moderate database homology
`O04253`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 6	67.687%	Swiss-Prot	moderate database homology
`Q8VYF4`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 7	64.217%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card