Gene Card
Gene overview
cDNA / CDS / Protein Sequences
831 bp · LXL04_025210|LXL04_025210|OH1004|cDNA
ATGGGGAAAGGTCCAGGCCTCTATCCCGATATCGGCAAAAAAGCCAGAGATCTTCTATACAGGGATTACCAAAGCGACCATAAGTTCTCTCTCACTACCTATGCTGCAAACGGCGTTGCCATTACCTCATCAGGATCCAGGAAAGGCGACTTGTACTTGGCAGATGTCAGCACTAAACTAGTCAACAAAAACATCACAACCGATGTCAAAGTAGACACAAACTCAAAGCTATTCACAACCATCACCGTCGATGAAGCTGC...
831 bp · LXL04_025210|LXL04_025210|OH1004|CDS
ATGGGGAAAGGTCCAGGCCTCTATCCCGATATCGGCAAAAAAGCCAGAGATCTTCTATACAGGGATTACCAAAGCGACCATAAGTTCTCTCTCACTACCTATGCTGCAAACGGCGTTGCCATTACCTCATCAGGATCCAGGAAAGGCGACTTGTACTTGGCAGATGTCAGCACTAAACTAGTCAACAAAAACATCACAACCGATGTCAAAGTAGACACAAACTCAAAGCTATTCACAACCATCACCGTCGATGAAGCTGC...
Protein
Download Protein FASTA276 aa · LXL04_025210|LXL04_025210|OH1004|PROTEIN
MGKGPGLYPDIGKKARDLLYRDYQSDHKFSLTTYAANGVAITSSGSRKGDLYLADVSTKLVNKNITTDVKVDTNSKLFTTITVDEAAPGLKTILSFIAPDQKSGKIELQYLHEYAGICTSIGLTASPIVNFSGVAGNNTVSLGTDVSFDTASGNFTKYNAALSFTTSDLIASVILNDKADTITASYYHTVSPLTNTAVGAELSHGFSSNENSLSIGTQHSLDPLTMVKARVNNAGIASAVLQHEWRPKSLFTISGEVDTR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025210 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025210 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:107694640-107696520 (+) | ||||||||||||
| Description | Similar to Mitochondrial outer membrane protein porin of 36 kDa | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009617 response to bacterium Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005773 vacuole Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009527 plastid outer membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0046930 pore complex Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G01280 dosa:Os09g0361400 sot:102580103 sot:102603136 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01459.29Porin_34-269 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025210 | PF01459.29 | Porin_3 | 4 | 269 | 1.2e-88 | 297.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.