Gene Card
Gene overview
cDNA / CDS / Protein Sequences
759 bp · LXL04_025205|LXL04_025205|OH1004|cDNA
ATGCTAAATCTATCAATATCTTCAAAGCAAGGAGGCTACATCATCCAAAACCCTAAATCCCCTTTCACATTAAACCCACATCTTTCTTCCCTACCTTCAATCAAATTCACAAACCCCACCTCCAAAAAACTCAGTCTGAAGTGTCAATACTCCGACCAACAACAACGGTCTGATGTTTCATCTTACTCTCAGCCAGAGGCTCCCAAGGTTTTCATCGGGCATTCGATATACAAAGGAAAAGCTGCTCTTACAGTTGAACC...
759 bp · LXL04_025205|LXL04_025205|OH1004|CDS
ATGCTAAATCTATCAATATCTTCAAAGCAAGGAGGCTACATCATCCAAAACCCTAAATCCCCTTTCACATTAAACCCACATCTTTCTTCCCTACCTTCAATCAAATTCACAAACCCCACCTCCAAAAAACTCAGTCTGAAGTGTCAATACTCCGACCAACAACAACGGTCTGATGTTTCATCTTACTCTCAGCCAGAGGCTCCCAAGGTTTTCATCGGGCATTCGATATACAAAGGAAAAGCTGCTCTTACAGTTGAACC...
Protein
Download Protein FASTA252 aa · LXL04_025205|LXL04_025205|OH1004|PROTEIN
MLNLSISSKQGGYIIQNPKSPFTLNPHLSSLPSIKFTNPTSKKLSLKCQYSDQQQRSDVSSYSQPEAPKVFIGHSIYKGKAALTVEPRPPEFAPLDSGAFKLTKEGFVLLQFAPAAGVRQYDWSRKQVFSLSVNEIGSLISLGAKNSCEFFHDPFKGKSDEGRVRKVLKVEPLPDGSGHFFNLSVQNKLINMDESIYIPVTKAEFAILVSAFNFAVPYLLGWHTFVNSIKPQDPTRLNNANPRSGADLEWSR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025205 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025205 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:107497788-107499097 (-) | |||||||||
| Description | Similar to WHY1: Single-stranded DNA-binding protein WHY1, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0009863 salicylic acid mediated signaling pathway Biological Process GO:0032204 regulation of telomere maintenance Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045910 negative regulation of DNA recombination Biological Process GO:0050832 defense response to fungus Biological Process GO:0000781 chromosome, telomeric region Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G14410 ath:AT2G02740 sot:102577544 sot:102577630 zma:100170235 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08536.18Whirly76-210 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025205 | PF08536.18 | Whirly | 76 | 210 | 4.3e-62 | 208.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.