Gene Card
Gene overview
cDNA / CDS / Protein Sequences
324 bp · LXL04_025174|LXL04_025174|OH1004|cDNA
ATGGATAGTGGGCTCATATTGTGTGTGCATTGTTCATTCCCGAAGTGTTCTTCCGTGACCCAAATGACCGAGAAGGGAGGGATTGATTTCTCAAAAGTTCCGGCGAGAAGATGGAGGAAGAAGTGTTATGTTTGCCGGAAAACAAATGGGTGTGCCATTGATTGCTCAGAGGAAAACTGTGGTTTGAGTTTTCATGTCACTTGTGGGTTGAAAGAAGATCTGTGTATCGAGTATAAGGAAGGGAGAAACAGCGGCGCCAT...
324 bp · LXL04_025174|LXL04_025174|OH1004|CDS
ATGGATAGTGGGCTCATATTGTGTGTGCATTGTTCATTCCCGAAGTGTTCTTCCGTGACCCAAATGACCGAGAAGGGAGGGATTGATTTCTCAAAAGTTCCGGCGAGAAGATGGAGGAAGAAGTGTTATGTTTGCCGGAAAACAAATGGGTGTGCCATTGATTGCTCAGAGGAAAACTGTGGTTTGAGTTTTCATGTCACTTGTGGGTTGAAAGAAGATCTGTGTATCGAGTATAAGGAAGGGAGAAACAGCGGCGCCAT...
Protein
Download Protein FASTA107 aa · LXL04_025174|LXL04_025174|OH1004|PROTEIN
MDSGLILCVHCSFPKCSSVTQMTEKGGIDFSKVPARRWRKKCYVCRKTNGCAIDCSEENCGLSFHVTCGLKEDLCIEYKEGRNSGAIVAGFCKSHTDLWTKVMHNTF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025174 |
|---|---|
| TK1151 ID | TkA07G328990 |
| OH-1004 ID | LXL04_025174 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 98.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025174 |
|---|---|
| Location | Chr05:107125724-107126047 (-) |
| Description | Similar to Kdm4b: Lysine-specific demethylase 4B |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0001558 regulation of cell growth Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0010468 regulation of gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0045740 positive regulation of DNA replication Biological Process GO:0050793 regulation of developmental process Biological Process GO:0051726 regulation of cell cycle Biological Process |
| KEGG gene cross-reference | hsa:23030 hsa:23338 hsa:27154 mmu:193796 mmu:76901 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13832.13zf-HC5HC2H_213-85 aaPF13771.13zf-HC5HC2H19-96 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025174 | PF13832.13 | zf-HC5HC2H_2 | 13 | 85 | 1.4e-13 | 51.7 |
| LXL04_025174 | PF13771.13 | zf-HC5HC2H | 19 | 96 | 3.5e-14 | 53.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.