LXL04_025135 | RubberDandelionOmics

Gene overview

LXL04_025135

Reference: OH-1004 Chr: Chr05 Coordinates: 106635482-106636297 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · LXL04_025135|LXL04_025135|OH1004|cDNA

ATGGAGCACATCACTGAGAATGGTTCTTCTCATTCATGGTGGCTTGACAACACTCATAATCGTCCCCATCAATCTCAATGGCTGCACTCGACTTTATCAGACTTGGAGAAGAAGGTAAAACATATATTAAGCTTAATTGAAGACGATGGCGATACATTTGCAGAAAGGGCTGAGATGTTCTACAAAAAAAAGCCTTTACTCATTAAATCCGTCGAAGATCTTCACGAATCGTACAAACATTTGGCTGAAAAGTACGACCA...

CDS

Download CDS FASTA

657 bp · LXL04_025135|LXL04_025135|OH1004|CDS

ATGGAGCACATCACTGAGAATGGTTCTTCTCATTCATGGTGGCTTGACAACACTCATAATCGTCCCCATCAATCTCAATGGCTGCACTCGACTTTATCAGACTTGGAGAAGAAGGTAAAACATATATTAAGCTTAATTGAAGACGATGGCGATACATTTGCAGAAAGGGCTGAGATGTTCTACAAAAAAAAGCCTTTACTCATTAAATCCGTCGAAGATCTTCACGAATCGTACAAACATTTGGCTGAAAAGTACGACCA...

Protein

Download Protein FASTA

218 aa · LXL04_025135|LXL04_025135|OH1004|PROTEIN

MEHITENGSSHSWWLDNTHNRPHQSQWLHSTLSDLEKKVKHILSLIEDDGDTFAERAEMFYKKKPLLIKSVEDLHESYKHLAEKYDQLIKRHENVRAFPNPNRFPQLQSSNADQNYETFKKKRCEFDDGLEKRWTEMGLTVMKLVEDNLEQQAELVKKNDQKREAINELCVHVRKLVAENNELKTKLARMEADIKRKRSQFSKAKEVILKKILPEPRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025135`
TK1151 ID	TkA06G079010
OH-1004 ID	LXL04_025135
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 73.394 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025135

Location Chr05:106635482-106636297 (-)

Description Similar to NET3A: Protein NETWORKED 3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03470`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g03080`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g58215`	Plant-specific actin binding protein.	No verified direct reference in this release
`At4g14760`	Plant-specific actin binding protein.	No verified direct reference in this release
`At2g47920`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025135 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G03080

ath:AT1G03470

ath:AT1G58215

ath:AT2G47920

ath:AT4G14760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.501

Rank 1 · LXL04_025135 · OH-1004

Nucleus0.431

Rank 2 · LXL04_025135 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_025135 · OH-1004

Mitochondrion0.050

Rank 4 · LXL04_025135 · OH-1004

Golgi apparatus0.040

Rank 5 · LXL04_025135 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07765.18KIP112-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025135	`PF07765.18`	KIP1	12	86	5.2e-30	104.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GR8`	Arabidopsis thaliana	Protein NETWORKED 3A	32.547%	Swiss-Prot	moderate database homology
`F4HZB5`	Arabidopsis thaliana	Protein NETWORKED 1D	43.396%	Swiss-Prot	weak database homology
`P0DMS1`	Arabidopsis thaliana	Protein NETWORKED 2A	39.831%	Swiss-Prot	moderate database homology
`F4JIF4`	Arabidopsis thaliana	Protein NETWORKED 1B	42.342%	Swiss-Prot	weak database homology
`O82259`	Arabidopsis thaliana	Protein NETWORKED 3C	32.979%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card