LXL04_025089 | RubberDandelionOmics

Gene overview

LXL04_025089

Reference: OH-1004 Chr: Chr05 Coordinates: 105781532-105783501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1242 bp · LXL04_025089|LXL04_025089|OH1004|cDNA

ATGACCAAATCCAATAACTTCTTTCACAACATCATCAAAACCTTCAATTCCAGCTCAAATAAAGAAAGCCAAAGCCAAGAAGAAGATTTGGGAAAGCTCGCTGCTCAAGATCAAAAAGTTTTCACTTTTCAAACCCTAGTTTCTGCAACAAAGAATTTCGATCCTGATAACAAGCTTGGTCAAGGGGGTTTCGGGCCTGTTTTCAAGGGTAAATTGGATAATGGAGTGGAGATTGCGGTGAAGAAATTATCCCAAACCTC...

CDS

Download CDS FASTA

1242 bp · LXL04_025089|LXL04_025089|OH1004|CDS

ATGACCAAATCCAATAACTTCTTTCACAACATCATCAAAACCTTCAATTCCAGCTCAAATAAAGAAAGCCAAAGCCAAGAAGAAGATTTGGGAAAGCTCGCTGCTCAAGATCAAAAAGTTTTCACTTTTCAAACCCTAGTTTCTGCAACAAAGAATTTCGATCCTGATAACAAGCTTGGTCAAGGGGGTTTCGGGCCTGTTTTCAAGGGTAAATTGGATAATGGAGTGGAGATTGCGGTGAAGAAATTATCCCAAACCTC...

Protein

Download Protein FASTA

413 aa · LXL04_025089|LXL04_025089|OH1004|PROTEIN

MTKSNNFFHNIIKTFNSSSNKESQSQEEDLGKLAAQDQKVFTFQTLVSATKNFDPDNKLGQGGFGPVFKGKLDNGVEIAVKKLSQTSNQGKKEFVNEAKLLARVQHRNVVDLLGYCVSPEKLLVYEYVPNESLDKLLFKSTRRDELDWKRRYDIICGVARGLLYLHEDAHDCIIHRDIKASNILLDEKWVPKIADFGMAKLYPEDQTHVHTRVAGTNGYMAPEYVMRGNLSVKADVYSFGVVVLELISGQKNFTFNLDPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025089`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025089

Location Chr05:105781532-105783501 (+)

Description Similar to CRK19: Cysteine-rich receptor-like protein kinase 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70740`	Cysteine-rich receptor-like protein kinase 43.	No verified direct reference in this release
`At4g23270`	Cysteine-rich receptor-like protein kinase 19.	No verified direct reference in this release
`At4g23180`	Cysteine-rich receptor-like protein kinase 10.	No verified direct reference in this release
`At4g11530`	Cysteine-rich receptor-like protein kinase 34.	No verified direct reference in this release
`At4g23280`	Putative cysteine-rich receptor-like protein kinase 20.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025089 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70740

ath:AT4G23180

ath:AT4G23270

ath:AT4G23280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.680

Rank 1 · LXL04_025089 · OH-1004

Cytoplasm0.268

Rank 2 · LXL04_025089 · OH-1004

Nucleus0.217

Rank 3 · LXL04_025089 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_025089 · OH-1004

Golgi apparatus0.028

Rank 5 · LXL04_025089 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr56-320 aa

PF00069.32Pkinase56-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025089	`PF07714.24`	PK_Tyr_Ser-Thr	56	320	2.4e-49	168.7
LXL04_025089	`PF00069.32`	Pkinase	56	319	4.8e-48	164.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAC3`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 43	63.043%	Swiss-Prot	strong database homology
`Q8GWJ7`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 19	47.075%	Swiss-Prot	moderate database homology
`Q8GYA4`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 10	49.547%	Swiss-Prot	moderate database homology
`Q9LDQ3`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 34	50.000%	Swiss-Prot	strong database homology
`O65479`	Arabidopsis thaliana	Putative cysteine-rich receptor-like protein kinase 20	50.645%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card