LXL04_025087 | RubberDandelionOmics

Gene overview

LXL04_025087

Reference: OH-1004 Chr: Chr05 Coordinates: 105714073-105714432 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · LXL04_025087|LXL04_025087|OH1004|cDNA

ATGGCGCCGCACACTGTTTCGGTTTCTGTTTCGGATTCGGATGATGAATTGGAGGTGATTGATCCTAGGGTTAGGTTGATGTTTTTCTCGAGTGAAGGCGATTTGGAAGGGATTAAGAAGCTACTGGATTCCGGAACCGATGTTAATTTCAAAGACATTGATAATCGAACAGCTTTGCATGTAGCAGCTTGTCGAGGGCTAACTGATGTTGCTGAATTGCTGCTGAAGGGCGGTGCTGAAATCCACCCCCAAGATAAAAA...

CDS

Download CDS FASTA

360 bp · LXL04_025087|LXL04_025087|OH1004|CDS

ATGGCGCCGCACACTGTTTCGGTTTCTGTTTCGGATTCGGATGATGAATTGGAGGTGATTGATCCTAGGGTTAGGTTGATGTTTTTCTCGAGTGAAGGCGATTTGGAAGGGATTAAGAAGCTACTGGATTCCGGAACCGATGTTAATTTCAAAGACATTGATAATCGAACAGCTTTGCATGTAGCAGCTTGTCGAGGGCTAACTGATGTTGCTGAATTGCTGCTGAAGGGCGGTGCTGAAATCCACCCCCAAGATAAAAA...

Protein

Download Protein FASTA

119 aa · LXL04_025087|LXL04_025087|OH1004|PROTEIN

MAPHTVSVSVSDSDDELEVIDPRVRLMFFSSEGDLEGIKKLLDSGTDVNFKDIDNRTALHVAACRGLTDVAELLLKGGAEIHPQDKKGSLIMVTSIVLLYPPIPGKVWYWLNVCPFPFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025087`
TK1151 ID	TkA06G081310
OH-1004 ID	LXL04_025087
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025087

Location Chr05:105714073-105714432 (+)

Description Similar to ILK1: Integrin-linked protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18950`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues (By similarity).	No verified direct reference in this release
`At2g43850`	Functions as a link between plant defense pathways, stress responses and potassium homeostasis.	No verified direct reference in this release
`At5g37500`	Major selective outward-rectifying potassium channel of the guard cell membrane.	The Arabidopsis outward K+ channel GORK is involved in regulation of stomatal movements and plant transpiration.2003 · DOI: 10.1073/pnas.0733970100

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025087 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007229 integrin-mediated signaling pathway Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009637 response to blue light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT2G43850

ath:AT4G18950

ath:AT5G37500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · LXL04_025087 · OH-1004

Nucleus0.410

Rank 2 · LXL04_025087 · OH-1004

Mitochondrion0.138

Rank 3 · LXL04_025087 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_025087 · OH-1004

Endoplasmic reticulum0.061

Rank 5 · LXL04_025087 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_226-87 aa

PF13637.13Ank_428-75 aa

PF00023.37Ank54-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025087	`PF12796.14`	Ank_2	26	87	1.7e-09	38.9
LXL04_025087	`PF13637.13`	Ank_4	28	75	7.2e-06	26.9
LXL04_025087	`PF00023.37`	Ank	54	86	1e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z30`	Arabidopsis thaliana	Serine/threonine-protein kinase 12	59.740%	Swiss-Prot	moderate database homology
`F4IS56`	Arabidopsis thaliana	Integrin-linked protein kinase 1	45.652%	Swiss-Prot	moderate database homology
`Q94A76`	Arabidopsis thaliana	Potassium channel GORK	42.105%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card